SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008527 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000008527
Domain Number - Region: 70-198
Classification Level Classification E-value
Superfamily PH domain-like 0.0386
Family Pleckstrin-homology domain (PH domain) 0.052
Further Details:      
 
Domain Number - Region: 342-409,443-545
Classification Level Classification E-value
Superfamily ARM repeat 0.0806
Family MIF4G domain-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008527   Gene: ENSMLUG00000009348   Transcript: ENSMLUT00000009355
Sequence length 922
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429832:868561:941736:-1 gene:ENSMLUG00000009348 transcript:ENSMLUT00000009355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEPQASEDKWSDECAELKWKTEAAIKNFSPFYSRQYSVAFCNHVRSEVEQQRDFTSQFLK
TKPPLDPGTVLYEAELCQFAEDIKKWKERYVVVKNDFAVESYENKEAYQRGAAPKSRILP
AGGKVLTSEEEYNLLSDRHFPDPLASNEKESTPPFVVPPKDFPVYLWQPFLRDGYFCFQE
AAEQKKFQALLSDCIRHLNQDYMKQTTFEAQAFLEAVQFFRQEKGHYGSWEMMTGDEIQI
LSHMVMEELLPTLQADLLPKMKGKKNDRKRAWHGLLEEAYNLVQQQVSEGLSALKEECRA
LTKGLEGTIRSDMDQIVNSKNFLTGKIRAAMVAQPAEKSCAESVQPFLASILEELMGPVS
SGFSEVRSLFEKEVDELSQNFQTSKDNAQLKEQTQHLDHLMNLPLDSVKMEPCYIKVNLL
QERLQDLKSRFRFPHVDLVVQQTQNYMQELMENAVFTFGQLLSPHLQGEASKTAIAIEKV
KLRVLKQYDYDSSTIRKRIFQEALIQITLPTVQKALASTCKPELQKYEQFIFADHTNMIH
VENVYEEILHQMLLDETLKVIKEAAILKKHNLFEDNMALPSESVSSLTDLKTPVGSNQAS
PARRASAILLGVADGETPSNDVFPEPEEKQQPGVPSPVAQEESLSSPGGDPQGVRSGTGD
PVVNPEAAEDTAGARGTRSSELELAGTPADREAATHQEPQPLSASCSLKELRSLLTVTVE
VPMVSATLETEKDTHPETLVPQEIDKEEETTQIHTEATQAAASSQDDSEEGGVGEREAHS
PAAEVEAEAGAGGVESGGCAEAQPACGGLSQGPSGPGPTEEQAEAGDPTGRDAHEGGKAV
PQGGCILNSAPMGPRESQVSAEEAVGGKSGPAQAAAGVGAEEVKGPRVYECQWVVENAPN
SDILGPQEEDARESPPDQPSEE
Download sequence
Identical sequences G1PDI0
ENSMLUP00000008527 ENSMLUP00000008527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]