SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008530 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008530
Domain Number 1 Region: 10-120
Classification Level Classification E-value
Superfamily Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 7.59e-29
Family Histone H3 K4-specific methyltransferase SET7/9 N-terminal domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008530   Gene: ENSMLUG00000009367   Transcript: ENSMLUT00000009358
Sequence length 146
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429833:1682104:1684669:1 gene:ENSMLUG00000009367 transcript:ENSMLUT00000009358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLTKGSFTYSSGEEYRGEWKEGRRHGFGQLMFADGGTYLGHFENGLFCGFGVLTFSDGS
RYEGEFAQGKFNGVGVFIRHDNMTFEGEFKNGRVDGFGLLTFPDGSHGIPRNEGLFENNK
LLRREKCSAVVQRAQSASKSARNLTA
Download sequence
Identical sequences G1PDI3 S7QEP1
ENSMLUP00000008530 XP_005885464.1.60319 XP_006090029.1.53796 XP_006090030.1.53796 XP_006756653.1.95426 XP_006756654.1.95426 XP_008142364.1.99482 ENSMLUP00000008530

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]