SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008541 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008541
Domain Number 1 Region: 8-104
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.77e-21
Family Ubiquitin-related 0.0000244
Further Details:      
 
Domain Number 2 Region: 648-658
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000732
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008541   Gene: ENSMLUG00000009350   Transcript: ENSMLUT00000009371
Sequence length 1123
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430352:208745:219978:1 gene:ENSMLUG00000009350 transcript:ENSMLUT00000009371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPNNSTSTTMEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLI
YQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTQLPSGASSGTGSASATHGGAPPLGTRGP
GASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPVQSEPRVRLVMAQHMIRDIQTLL
SRMECRGGPQAQPSQPPAQTPTVAPEPGALSSQPSDPSESEAPSREPMEAEAEERAPAQS
PELTPGPAPAGPTPVPETSAPNHPSPAEYIEVLQELQRLESRLHPFLQRYYEVLGAAAST
DYNNNQEGREEDQRLINLVGESLRLLGNTFVALSDLRCNLACAPPRHLHVVRPMSHYTTP
MVLQQAAIPIQINVGTTVTMTGNGTRPPPTPSAEASPPGPGQASPLAPSSATVESTEGAP
PPGPAPPPTASHPRVIRISHQSVEPVVMMHMNIQDSGTQPGGVPSAPTGPLGPPGHGQTL
GQQGPGFPAAPTRVVIARPTPPQARPSHPGGPPVSGTLQGAGLGTNASLAQMVSGLVGQL
LMQPVLVAQGTPGMAPPPAPATASASAGTTNTATTAGPAPGGPTQPPPTQPSTTDVQFSQ
LLGNLLGPAGPGAGGPGMASPTITVAMPGVPAFLQGMTDFLQATQTAPPPPPPPPPPPLA
PEQQTMPPPGSPSGGAGSPGGLGPESLSPEFFTSVVQGVLSSLLGSLGARAGSSESIAAF
IQRLSGSSNIFEPGADGALGFFGALLSLLCQNFSMVDVVMLLHGHFQPLQRLQPQLRSFF
HQHYLGGQEPTPGNIRMATHTLITGLEEYVRESFSLVQVQPGVDIIRTNLEFLQEQFNSI
AAHVLHCTDSGFGARLLELCNQGLFECLALNLHCLGGQQMELAAVINGRIRRMSRGVNPS
LVSWLTTMMGLRLQVVLEHMPVGPDAILRYVRRIGDPPQPLSEEPMEVQGSERTSPEPQR
ENASPAPGTTAEEAMSRGPPPAPEGGSQEEQDGASAETEPWAAAVPPEWVPIIQQDIQSQ
RKVKPQPPLSDAYLSGMPAKRRKTMQGEGPQLLLSEAVSRAAKAAGARPLTSPESLSRDL
EAPEVQESYRQQLRADIQKRLQEDPNYSPQRFPSAHRAFAEDP
Download sequence
Identical sequences G1PDJ1
XP_006104693.1.53796 XP_006104694.1.53796 ENSMLUP00000008541 ENSMLUP00000008541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]