SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008542 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008542
Domain Number 1 Region: 491-656
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 3.4e-70
Family A middle domain of Talin 1 0.0000003
Further Details:      
 
Domain Number 2 Region: 756-891
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.75e-53
Family I/LWEQ domain 0.00000186
Further Details:      
 
Domain Number 3 Region: 661-785
Classification Level Classification E-value
Superfamily I/LWEQ domain 3.92e-52
Family I/LWEQ domain 0.00000418
Further Details:      
 
Domain Number 4 Region: 2298-2488
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.08e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1842-1976
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.43e-47
Family VBS domain 0.00000732
Further Details:      
 
Domain Number 6 Region: 1227-1365
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.57e-39
Family VBS domain 0.026
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 8.37e-32
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 8 Region: 1075-1209
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 6.12e-29
Family VBS domain 0.012
Further Details:      
 
Domain Number 9 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 9.99e-25
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 10 Region: 1473-1559
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000118
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 2008-2135
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000298
Family VBS domain 0.013
Further Details:      
 
Domain Number 12 Region: 1700-1818
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000173
Family VBS domain 0.063
Further Details:      
 
Domain Number 13 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000271
Family Ubiquitin-related 0.07
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008542
Domain Number - Region: 946-1044
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.000149
Family I/LWEQ domain 0.0029
Further Details:      
 
Domain Number - Region: 1588-1663
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000345
Family VBS domain 0.041
Further Details:      
 
Domain Number - Region: 2110-2231
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0615
Family I/LWEQ domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008542   Gene: ENSMLUG00000009302   Transcript: ENSMLUT00000009372
Sequence length 2544
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429882:3637231:3818789:-1 gene:ENSMLUG00000009302 transcript:ENSMLUT00000009372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRFIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGAVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKVEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATDDSELLKQVGAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKA
VADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALSTVQTLKNELQDAKMAAADSQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTSDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAESQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARHRAVTESINQLITLCTQQAPGQKECDNALRELETVKGM
LDNPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGL
TEAAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAAT
IVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRN
KCRIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRT
ARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIE
QASLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLAS
YFEPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAIT
EAAQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDDGTPPEPKGTFVDYQTTV
VKYSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLALQGQMAAATAEPEEIGFQIR
TRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQA
CITAATAVSGIIADLDTTIMFATAGTLNAENNETFADHRENILKTAKALVEDTKLLVSGA
ASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLIGA
TKGAASKPADDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIEYMKQEL
TVFQSKEVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLM
ACKQASFHPDVSEDVRARALRYGTECTLSYLDLLEHVLVVLQKPTPELKHQLAALSKRVA
GAVTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADE
TLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAA
RMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQ
AAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEA
RKKLAQIRQQQYKFLPTELREDEG
Download sequence
Identical sequences G1PDJ2
ENSMLUP00000008542 ENSMLUP00000008542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]