SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008576 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008576
Domain Number 1 Region: 313-482
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-58
Family SPRY domain 0.0000101
Further Details:      
 
Domain Number 2 Region: 9-90
Classification Level Classification E-value
Superfamily RING/U-box 3.28e-20
Family RING finger domain, C3HC4 0.013
Further Details:      
 
Domain Number 3 Region: 93-154
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 8.55e-18
Family B-box zinc-binding domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008576   Gene: ENSMLUG00000009420   Transcript: ENSMLUT00000009410
Sequence length 506
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430069:251355:264474:1 gene:ENSMLUG00000009420 transcript:ENSMLUT00000009410 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAVELSRKLQEEATCSICLDYFTDPVMTSCGHNFCRECIRLTWEKAKGKKGRRKRRGVF
PCPECRELSPQRTLRPNRLLTKVAEMARQHPGIQSRDLCQVHQEVLKLFCEDDQSPICVV
CRESQEHRPHRVVPVEEAVKEHKLKLEGDMGHLREEMAKTEKLQTREQQALAEWQKMVES
QRQNVRAEFERLRRLLAEEEQRLLQRLEEEELEVLPPLQESAVRLGQQSAQLADLVAELE
GRCQLPALGLLQDIMDTLRRVQEVKLQPPKVVPMEMRTVCRVPGLVEALQRFRGRLHAGW
RKGPEVTTALSAGDITLDPDTANPELVLSEDMQSVRRGDLRQPLPDSPERFDPGPCVLGR
EPLSSGRHYWEVEVGERASWALGVCRENANRKEKGELFAGNGFWILVFLGGFYNSSERAF
APLRDPPRRVGIFLDYEAGHLAFYSATDGSLLYAFPETPFSGTLRALFSPLSSSPTPMTI
CRPKGGLGDGLASHMGHCGLLQNVLP
Download sequence
Identical sequences G1PDM3
ENSMLUP00000008576 ENSMLUP00000008576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]