SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008637 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008637
Domain Number 1 Region: 1045-1347
Classification Level Classification E-value
Superfamily RNI-like 1.57e-40
Family 28-residue LRR 0.011
Further Details:      
 
Domain Number 2 Region: 519-636
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-30
Family Ankyrin repeat 0.00048
Further Details:      
 
Domain Number 3 Region: 67-96,164-278,335-384
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000717
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 
Domain Number 4 Region: 9-140
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000166
Family Tetratricopeptide repeat (TPR) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008637   Gene: ENSMLUG00000009463   Transcript: ENSMLUT00000009477
Sequence length 1368
Comment pep:known_by_projection scaffold:Myoluc2.0:GL431009:69404:80626:1 gene:ENSMLUG00000009463 transcript:ENSMLUT00000009477 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLDRELRQLNKAKARAQNSGQLREEAALCHQLGELLASHGRYSEALQEHQQELRLRESA
EDALGCAVAHRKIGERLAEMEDYSAALQYQQHYLELACSLSNHIEVQRAWATIGRTHLDV
YDHSQSQEALLQARAAFEKSLAIVDEKLHRTLPKRELSEMRARLYLNLGLTFESLRQTAL
CNDYFKKSIFLAEQNHLYEDLYRARYNLGAIHWRQGQHSQAMRCLEGARECAHTMRKGFM
ESECCVLISQVLQDLGDFLAAKRALKKAYRLGSQKPLQRAAVCQTLKYAVLAVVRLQQQL
EESESSDPQSAMGICEQLGDLFSKAGDFPKAAKAYQKQLDFAERLDRPGPELAVIHVSLA
ATLGDMKDPRGAVHHYEEELRLREGNALEEAKTWLNIALSREEAGDTYEELAPCFQKALG
CAQQAQRPQLQRQVLQHLHTVQLRLQPQEAPGTKARLQELRVDQDEEEEEEDGEGEEASD
TMEASEVELSDSVTEGESQSQDLEEEEELRGCLGRQQVNKWNRRNDVGETLLHRACIEGQ
LHRVQDLVRQGHPLSPRDYCGWTPLHEACNYGHLDIVRFLLDHGAAVDDPGGQGCEGITP
LHDALNCGHFEVAELLIERGASVTLRTRKGHSPLETLQQWLRLYHRDLDRETREKAGAME
RRLREAASGRAPHSPLAPRSLPSDHLFDPETSPSSSPCPGLPEASQASARVCEAQAVPAV
ARPRRSRHQLASSSSSEGEDSGGPPGAPQKRPRHSAPAQRAGACTLGRVNNRKVAAAGRA
AYCAAIRGVGSAQSCRPKPGPPRGPGEAPTPTAALIPEEECLAGAWLEDDLPLTQGRRPP
HPQSRGHRTRRSASESSSDESPVRPRAQARQSQLSRLRSWSAAVRAGADGSSAMEPLRSP
HVPGSGDTPAAGLSSGPVLPPTIRVRVRVQDNLFLIPVPHSKEAHSVAWLAEQAAQRYYQ
ACGLLPRLTLRKEGALLAPQDPIPDVLQSNEEVLAEVTSWDLPPLTDRYRRACQSLEQGE
HPQVLQAMERQGVGPLFSACSLALRQAQLTPLLRALKLHSALRELRLAGNRLGDGCATEL
LAALDTLPGLTLLDLSSNHLGPEGLCQLASGLVGKATLQNLEELDLSMNPLGDGCSQALA
SVLRACPALSTLHLRACGFGPGFLLSHQAALGRAFLDAKHLKTLSLSYNILGTTALSQTL
QSLPAQTLLHLEVSSMVASKTDPGLVEPVVRYLTKEGCALAHLNLSANHLGDQAVRDLSR
CLPLCPSLVSLDLSANPEISCAGLEELLSALQERPQGLSFLGLAGCTVRGPLGPGLWDKI
AARLQELQLCSRRLSAEDRAALGQLLSGQSDPAARTLDRGSRLFFRRL
Download sequence
Identical sequences G1PDS7
ENSMLUP00000008637 ENSMLUP00000008637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]