SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008706 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008706
Domain Number 1 Region: 571-758
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.75e-46
Family cAMP-binding domain 0.00047
Further Details:      
 
Domain Number 2 Region: 301-476,506-567
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-43
Family Voltage-gated potassium channels 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008706   Gene: ENSMLUG00000009544   Transcript: ENSMLUT00000009555
Sequence length 1095
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429772:17234966:17381394:1 gene:ENSMLUG00000009544 transcript:ENSMLUT00000009555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSTFICNTHIIPVKNQEGVAMMFIINFEYVTDEENAASPERVNPILPVKTINRKLFGFK
FPGLRVLTYRKESLPQEDPDVVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQ
PSKCSPLVNISGPLDHSSPKRQWDRLYPDMLQSSSKLTHSRSKESLCSIRRASSVHDMEG
FSVHPKNIFRDRHASEDNGRNVKGPFNHIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSD
VKTEKKNTSPPSSDKTIIAPKVKDRTHNVTEKVTQVLSLGADVLPEYKLQTPRINKFTIL
HYSPFKAVWDWLILLLVIYTAIFTPYSAAFLLNDREEQKRRECGYSCSPLNVVDLIVDIM
FIIDILINFRTTYVNQNEEVVSDPAKIAIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTT
LIGLLKTARLLRLVRVARKLDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVERPYL
TDKIGWLDSLGEQIGKRYNDSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEK
IFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLE
EYFQHAWTYTNGIDMNMVLKGFPECLQADICLHLNQTLLQNCKAFRGASKGCLRALAMKF
KTTHAPPGDTLVHCGDVLTALYFLSRGSIEILKDDIVVAILGKNDIFGEMVHLYAKPGKS
NADVRALTYCDLHKIQREDLLEVLDMYPEFSDHFLTNLELTFNLRHESAKRSQSMNDSEG
DNCKLRRRKLSFDSEGETDFGKGNSTNDAEDSGDTIRNYQSSKKHTEEKKSRSSSFISSI
DDEQKPLFSGIVDSPPGVGKATGLNFKEVVSTSGRIHIDKRSHSCKDISDTRSWEQENAR
TQADESSHSAPQQTAWGISETESDLTCGEVEQRLDLLQEQLNRLESQMTADIQTILQLLQ
KQTTVVPPAYSMVTAAAEYQRPTIHLMRTSHPRASIKTDQSFSPSSQCPEFLDLDKSKLK
SKESLSSGVHLNTASEDNLPSRLKQDSELSLELHSRQRKTYLHPIRHPSLTDSSPSTAGI
LGLHRHVSDPGLPGK
Download sequence
Identical sequences G1PDY8
ENSMLUP00000008706 ENSMLUP00000008706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]