SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008845 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008845
Domain Number 1 Region: 91-192
Classification Level Classification E-value
Superfamily SH2 domain 9.29e-32
Family SH2 domain 0.0000522
Further Details:      
 
Domain Number 2 Region: 9-91
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000249
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008845   Gene: ENSMLUG00000009709   Transcript: ENSMLUT00000009705
Sequence length 261
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429827:6164583:6188050:-1 gene:ENSMLUG00000009709 transcript:ENSMLUT00000009705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSQPSRGKSLPSPSSSPSVQDQGPVPMQPERRKATAVALGSFPVGEQAELSLRLGEPLT
IISEDGDWWTVLSEGSGREYSVPSIHVAKISHGWLYEGLSREKAEELLLLPGNPGGAFLI
RESQTRRGCYSLSVRLSRPASWDRIRHYRIQRLDNGWLYISPRFTFPSLQALVDHYSELA
DDICCLLKKPCALRRAGPVPGKDIPLPVTVQRAPLNWKELDSSLLFSEAPATGEASLISE
GLREALSSYISLTDDISLDDA
Download sequence
Identical sequences G1PEA9
ENSMLUP00000008845 ENSMLUP00000008845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]