SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008847 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008847
Domain Number 1 Region: 27-321
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.91e-60
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008847   Gene: ENSMLUG00000009702   Transcript: ENSMLUT00000009707
Sequence length 402
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430741:116976:121821:-1 gene:ENSMLUG00000009702 transcript:ENSMLUT00000009707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLNPAAVADNVERADALQLSVEDFV
ERYERPYKPVVLLNAQEGWSAQEKWTLERLKRKYRNQKFKCGEDNDGYSVKMKMKYYIEY
MESTRDDSPLYIFDSSYGEHPKRRKLLEDYKVPKFFTDDLFQYAGEKRRPPYRWFVMGPP
RSGTGIHIDPLGTSAWNALVQGHKRWCLFPTSTPRELIKVTRDEGGNQQDEAITWFKIIY
PRTQLPTWPPEFKPLEILQKPGETVFVPGGWWHVVLNLDTTIAITQNFSSTNFPVVWHKT
VRGRPKLSRKWYRILKQEHPELAVLADSVDLQESTGIASDSSSDSSSSSSSSSSDSDSEC
ESGSEGDGTMHRRKKRRTCSMMGNGDTTSQDDCVSKERSSSR
Download sequence
Identical sequences G1PEB1
ENSMLUP00000008847 ENSMLUP00000008847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]