SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008880 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMLUP00000008880
Domain Number - Region: 106-130
Classification Level Classification E-value
Superfamily Cyclophilin-like 0.0932
Family Cyclophilin (peptidylprolyl isomerase) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008880   Gene: ENSMLUG00000009754   Transcript: ENSMLUT00000009740
Sequence length 389
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429868:1758558:1769948:-1 gene:ENSMLUG00000009754 transcript:ENSMLUT00000009740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WVVRRTPRSSPSARPRSCPAPAPRPAAPDGSRAAARLSLACLLLLLLLTLPARVDTSWWY
IGALGARVICNNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTTLD
RDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQRGD
FDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCHGV
SGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTDLVYF
DNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFHWC
CAVRCKECRNTVDVHTCKAPKKAEWLDQT
Download sequence
Identical sequences G1PEE0
ENSMLUP00000008880 ENSMLUP00000008880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]