SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008887 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008887
Domain Number 1 Region: 9-248,299-330
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-54
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008887
Domain Number - Region: 310-385
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0317
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008887   Gene: ENSMLUG00000009717   Transcript: ENSMLUT00000009747
Sequence length 729
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429956:868307:917098:1 gene:ENSMLUG00000009717 transcript:ENSMLUT00000009747 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSTSNHLWLLSDILGQGATANVFRGRHKKTGDLYAIKVFNNISFLRPVDVQMREFEVLK
KLNHKNIVKLFAIEEETTTRHKVLIMEFCPCGSLYTVLEEPSNAYGLPESEFLIVLRDVE
VGGMNHLRENGIVHRDIKPGNIMRVIGEDGQSVYKLTDFGAARELEDDEQFVSLYGTEEY
LHPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIIT
GKPSGAISGVQKAENGPIDWSGDMPLSCSLSQGLQVLLTPVLANILEADQEKCWGFDQFF
AETSDILHRMIIHVFSLQRMTAHKIYIHSYNTATVFHELVYKQTNISSANQELIYEGRRL
VLEPGRLGQHFPKTTEENPIFVVSRESLETVGLKYEKISLPKVHPRYDLDGDASMAKAMT
GVVCYACRIASTLLLYQELMRKGIRWLIELVKDDYNETVHKKTEVVITLEFCLRSIQSMK
VYEKLLKTNLEATDLDEISDIHTKLLRLSSSRGTIENSLQDIESKLSPGGLLSDTWAHQE
GTHPKDRHVEKLQVLLNWITEIYYQFKKDKAERKLPYNEEQIHKFDKQKLYYHATKAMTH
FTDECVKKYETFLAKSGEWMRKMLQLKKQLLSLTNQCLDIEEEISKYQDYTNELQETLPQ
KMFAASSGIKHTMAPIYPCSNTLVEMTLGMKKLKEEMEGVVKELAENNHILERFGSLTMD
GGLRNVDCL
Download sequence
Identical sequences G1PEE6
ENSMLUP00000008887 ENSMLUP00000008887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]