SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008920 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008920
Domain Number 1 Region: 271-350
Classification Level Classification E-value
Superfamily SH3-domain 1.3e-22
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 2 Region: 108-168
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-21
Family SH3-domain 0.00078
Further Details:      
 
Domain Number 3 Region: 4-61
Classification Level Classification E-value
Superfamily SH3-domain 5.78e-19
Family SH3-domain 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008920   Gene: ENSMLUG00000009776   Transcript: ENSMLUT00000009785
Sequence length 641
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430048:983685:1080412:1 gene:ENSMLUG00000009776 transcript:ENSMLUT00000009785 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE
TESKDDNLPIRRERHGNVASLVQRISTYGLPAGGIQPHPPTKNIKKKIKKRQCKVLFEYI
PQNDDELELKVGDIIDINDEVEEGWWSGTLNNKLGLFPSNFVKELEITDDGETHEAQEDS
ESVWTGPTLSFPSQGNGNETAPGSVTQPKKIRGIGFGDIFKEGSVKLRTRASSSETEEKK
SEKPSIIQSLGSRTQNTEITKSDTEGKTKAKEYCRALFAYEGTNEDELTFKEGDIIHLIS
KETGETGWWKGELNGKEGVFPDNFAVQLNELDKDFPKPKKPPPPAKGPAPKPEPISIEKK
YFPVKPEERESDEKSMLDQKPSKPAAPQVPPKKPTPPTKVNNLLRSSGTVYPKRPEKPVP
PLPPVARINGEVPAISSKFETEPVSKPKLDSEQSPLRPKSVDLDSFTIRSFKETDIVNFD
DIASSENLLHLTANRPKMPGRRLPGRFNGGHSPTQSPEKILKSPKEEDSANIKPSEFKKD
SCNSPKPSLYLSTPSSPSKPNAASFLTPLEIKAKLEADDGKKSSLDEIKAEMIELLCIVE
ALKKEHGKELEKLRKDLEEEKALRSNLEVEIEKLKKAVLSS
Download sequence
Identical sequences G1PEH6
ENSMLUP00000008920 ENSMLUP00000008920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]