SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008940 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008940
Domain Number 1 Region: 780-847
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000795
Family IBR domain 0.0000195
Further Details:      
 
Domain Number 2 Region: 68-163
Classification Level Classification E-value
Superfamily PUG domain-like 0.00000000000222
Family PUG domain 0.0047
Further Details:      
 
Domain Number 3 Region: 697-762
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000247
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Domain Number 4 Region: 351-376
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00000392
Family Ran binding protein zinc finger-like 0.0022
Further Details:      
 
Domain Number 5 Region: 860-931
Classification Level Classification E-value
Superfamily RING/U-box 0.00000883
Family RING finger domain, C3HC4 0.049
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008940
Domain Number - Region: 301-326
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.000106
Family Ran binding protein zinc finger-like 0.0025
Further Details:      
 
Domain Number - Region: 572-612
Classification Level Classification E-value
Superfamily UBA-like 0.000132
Family UBA domain 0.011
Further Details:      
 
Domain Number - Region: 408-433
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.00424
Family Ran binding protein zinc finger-like 0.0043
Further Details:      
 
Domain Number - Region: 216-247
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0209
Family TFIIH p44 subunit cysteine-rich domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008940   Gene: ENSMLUG00000009787   Transcript: ENSMLUT00000009806
Sequence length 1071
Comment pep:novel scaffold:Myoluc2.0:GL430173:634147:646055:-1 gene:ENSMLUG00000009787 transcript:ENSMLUT00000009806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGEEEQRAFLAAREELASALRKDSGQAFSLEQLWPLLVTSLPPSARYQQLDAARLIRCN
ARGEPRTYLSTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLR
LYGYTEEQPDGLSFPEGQEDPDEHQVATVTLEVLLLRTELSLLILQNNHPRQQALEQLLN
DKAEDDMLQLSEFAPLLREIAPGPLITPSAPGSTPGPCFLCGSAPGTLHCSACKQALCPA
CDRLFHGHPSRAHHLRQTWAPHAANLTPSLPPAAPPLPQLTSLLALGDNSLSSPDPASVR
LSWHCATCSVLNKPWAVLCEACDRPRGCKGLGLEIEGPQGAGGLEPELARGHWACQSCTF
ENEPAAVLCAMCERPRLAQPPSLVVDSQDGGICLQPLQQKDTLLSSDQTSIWYCIHCTFC
NSGPGWVCAMCNRTSSPIPVKHASRPNASSLEERLPNPEPPRRLSAPLPSSCGDSEKQRQ
DKMREEGRQLVIKIREGEAAGACPEEVFSALQYSGTEVPLQWLHSELPYVLEMVAELAGQ
REPGLGAFSCQEAQKAWLDRHGNLDEAVEECVRVRRRKVQELRSLGFGPEEGSLQALYQH
GGDVARALTELQRQRLEPFHQRLWDSGPEPTPSWDSSDKQSLVRRLLAVYTLPSWGRAEL
ALSLLQETPRNYELGDVVEAVRQSQDRAFLRRLLAQECAVCGWTLPRNRMQALTSCECTI
CPDCFRQHFTIALKEKHITDMVCPACGRPDLTDDTQLLSYFSTLDIQLRESLEPDAYALF
HKKLTEAVLMRDPKFLWCAQCSFGFIYEREQLEATCPQCRQTFCVRCKRQWEEQHRGRSC
EDFQNWKRNNDPEYQAQGLAMYLQENGIDCPKCKFSYALARGGCMHFHCTQCRHQFCSGC
YNTFYAKNKCPDPNCRVKKSLHGHHPRDCLFYLRDWSALRLQKLLQDNQVMFNTEPPAGA
RAVPGGGCRVMEQKEVPNGLRDEACGKETPAGYAGLCQAHYKEYLVSLINAHSLDPATLY
KVEELETAVERYLHVHPQPLAGEDAPAYHARLLQKLMEEVPLGQSIPRRRK
Download sequence
Identical sequences G1PEJ3
ENSMLUP00000008940 ENSMLUP00000008940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]