SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008949 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008949
Domain Number 1 Region: 10-122
Classification Level Classification E-value
Superfamily PH domain-like 5.75e-36
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 2 Region: 145-256
Classification Level Classification E-value
Superfamily PH domain-like 0.000000528
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008949   Gene: ENSMLUG00000009812   Transcript: ENSMLUT00000009816
Sequence length 362
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429784:8142601:8235558:-1 gene:ENSMLUG00000009812 transcript:ENSMLUT00000009816 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLKRASCLCLLAVKYMREATPYVKKGSPVSEIGWETPPPESPRLGSGSSDPLASSSQPFS
FHRDRKNIPLRMCYVTRSMALADPENRQLEIHSPDAKHTVILRGKDSATAQAWFSAIHSN
VSDLLTRVIAEVREQLGKTGIAGSREIRHLGWLAEKVPGENEKQWKPALVVLTDKDLLIY
DSMPRRKEAWMSPVHMHPLLSTRLVHSGPGKGSPQAGVDLSFATRTGTRQGIETHLFRAE
ISRDLSHWTRSIVQGCHNSAELITEVTTACTYRNQECRLTIHYDNGFSITTEPQEGAFPK
TIIQAPYEKLKMSSDDGIRMLYLDFGGKDGEIQLDLHSCPKPIVFIIHSFLSAKITRLGL
VA
Download sequence
Identical sequences G1PEK1
ENSMLUP00000008949 ENSMLUP00000008949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]