SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008951 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008951
Domain Number 1 Region: 601-782
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-68
Family SPRY domain 0.00000273
Further Details:      
 
Domain Number 2 Region: 3-89
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-22
Family Pyrin domain, PYD 0.0021
Further Details:      
 
Domain Number 3 Region: 378-438
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.72e-16
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008951   Gene: ENSMLUG00000009793   Transcript: ENSMLUT00000009819
Sequence length 788
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429839:4739858:4753442:1 gene:ENSMLUG00000009793 transcript:ENSMLUT00000009819 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTPSDYLLHSLEELVPYDFEKFKFKLQNTSLEKEQQRIPRGLLPSARPVKLADLLLNH
YGEKYAVQLTLQILRAMNQHLLAEELHRAIDPEYPIQESGTDCPAMSCSSGENKPKSLKM
PDGLEGDRQQQSGDGAASQPEAGKGPQKKPQGKRRDQKGSEGLDVQGKPGARGGTLCSRR
SPLPSKQPGEKGSDSSVRLRRNASSAGRLQGLSSGSYAGSLGRKASEARSPSKKNRPRSL
EFTISSRERALSNLETLLPQEKVRSENLDSSATPSKVATLDAGATMAVEKGSRNPEHSVT
RRPQDEAVCPLSRAQEGDLVGSTCVRDSGSCSIASKDPKASDGCLPNCLRCQVSLPGKSS
GGIEPQEGPPMGSLSPTLQPQCTRHRKQVQLLFCEDHREPICLICSLSQEHRGHRVRPIE
EAALEYKEQIQKELEHLKALRRSGEEQRSEGDKNTANYLKQTEIQKQRVRCQMEQLCRFL
EQQERLFVAWLEKLAQTIVQVGETYDTQVSRDIALLTELIEELETKQRQPEWELMQDIGV
TLRRVKTVTVPEPWATPLEVKEKIHLLLQKSEFVEKSMKHFSGTLRSEMETFNVPELIDA
QTHAVNVVLDAETAHPNLIISDDLKSARLGNKWIHMPDSPERFDSCIFALGSPSFRSGRH
YWEVEVGDKTGWVLGICKASTSRKGNMTLSPENGYWVVMMMKRNEYQASTFPPTRLRMRE
PPRRVGIFLDYKAGDISFYNVTAKSHIYTFTSFSFSGPLQAIFSPGTHDGGKNMDPLTIC
PVGDQGPH
Download sequence
Identical sequences G1PEK3
ENSMLUP00000008951 ENSMLUP00000008951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]