SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008956 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008956
Domain Number 1 Region: 498-676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.73e-44
Family SPRY domain 0.003
Further Details:      
 
Domain Number 2 Region: 185-250
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.02e-17
Family B-box zinc-binding domain 0.0000132
Further Details:      
 
Domain Number 3 Region: 21-108
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000106
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 4 Region: 395-503
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000184
Family Fibronectin type III 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008956
Domain Number - Region: 126-181
Classification Level Classification E-value
Superfamily RING/U-box 0.0023
Family ZZ domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008956   Gene: ENSMLUG00000009829   Transcript: ENSMLUT00000009824
Sequence length 705
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:27972945:28064528:-1 gene:ENSMLUG00000009829 transcript:ENSMLUT00000009824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGESPASVVLNASAGLFSIKMETLESELTCPICLELFEDPLLLPCAHSLCFSCAHRILVS
SCSSGESIEPITAFQCPTCRYVISLNHRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSES
RRERTYRPSTTMSSERIACQFCEQDPPRDAVKTCITCEVSYCDRCLRATHPNKKPFTSHR
LVEPVPDTHLRGITCLDHENEKVNMYCVSDDQLICALCKLVGRHRDHQVASLNDRFEKLK
QTLEMNLTNLVKRNSELENQMAKLIQICQQVEVNTAMHEAKLMEECDELVEIIQQRKQMI
AVKIKETKVMKLRKLAQQVANCRQCLERSTVLINQAEHILKENDQARFLQSAKNIAERVA
MATASSQVLIPDINFNDAFENFALDFSREKKLLEGLDYLTAPNPPSIREELCTASHDTIT
VHWISDDEFSISSYELQYTIFTGQANFISLYNSVDSWMIVPNIKQNHYTVHGLQSGTRYI
FIVKAINQAGSRNSEPTRLKTNSQPFKLDPKMTHKKLKISNDGLQMEKDESSLKKSHTPE
RFSGTGCYGAAGNIFIDSGCHYWEVVMASSTWYAIGIAYKSAPKNEWIGKNASSWVFSRC
NSNFVVRHNNKEMLVDVPPQLKRLGVLLDYDNNMLSFYDPANSLHLHTFDVTFILPVCPT
FTIWNKSLMILSGLPAPDFIDYPERQECNCRPQESPYVSGMKACH
Download sequence
Identical sequences G1PEK8
ENSMLUP00000008956 ENSMLUP00000008956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]