SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008966 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008966
Domain Number 1 Region: 20-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.51e-67
Family FCH domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008966   Gene: ENSMLUG00000009831   Transcript: ENSMLUT00000009837
Sequence length 334
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429783:4072206:4100819:1 gene:ENSMLUG00000009831 transcript:ENSMLUT00000009837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPASLHSSHWESPDILSTIGYDSIIHHLNNGRKNCKEFEDFLKERASIEERYGKDLLNLS
RKKPCGQSEINTLKRALEVFKQQVDNVAQCHIQLAQTLREEARKLEEFREKQKLQRKKTE
LIMDAAHKQRSLQFKKTMDAKKIYEQKCRDKDDAEQAVHRSANLVNPKQQEKLFVKLATA
KTAAEDSDKAYMLHINTLDKIREEWQSEHIKACEALEAQEYERINFFRNALWLHVNQLSK
QCVTSDEMYEEVRKSLEMCSIEKDIEYFVNQRKTGQMPPAPIMYENYYCPQKNAAPPGKA
TGPNLARRGPLPIPRSLPDDPDYSSVDDYSLIYQ
Download sequence
Identical sequences G1PEL7
ENSMLUP00000008966 ENSMLUP00000008966

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]