SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000008988 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000008988
Domain Number 1 Region: 482-811
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 9.37e-54
Family Diacylglycerol kinase-like 0.0085
Further Details:      
 
Domain Number 2 Region: 981-1099
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.18e-19
Family Ankyrin repeat 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000008988
Domain Number - Region: 285-335
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.012
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000008988   Gene: ENSMLUG00000009836   Transcript: ENSMLUT00000009860
Sequence length 1115
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429864:3686083:3698477:-1 gene:ENSMLUG00000009836 transcript:ENSMLUT00000009860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METFFRRHFQWKAPGPGEGQRRPGGMGLPTGKARRRSPAGQASSSLAQRRRSSAQVQGCL
LSCGMRAQGTSRRRSSTAPPARNPRFIVNEVPTSHPATVGAQLLGAPLLLAGLVGMSEEK
EEEGVQEEDVTVAALSTTQRDTKRSGPSPPQGAGTLLPASRCLHGRRASHLLPADAVYDR
ALWGLHGYYRRLSQQRPPGPGGRRASGTTASPVTPGRVRPLSRRRQVALRRKSAGPQAWS
ALLAKAITKSGLQHLAPPLPALGAPCSEPERQIRSTVDWSESATYGEHIWFETNVSGDFC
YVGEQYCVAKMLKSVPRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNVREPTFV
RHHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPC
SLGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPFIIRPTPS
PLMKPLLVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILA
CGGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEE
GNVVQLDRWDLRAEPNPEAGPEEREEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREAN
PEKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGTDLTPKIQDLKPQCIVFLNI
PRYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVVLT
TSKAIPVQVDGEPCKLTASRIRIALRNQATMVQKAKRRSATPLHSDQQPVPEQLRIQVSR
VSMHDYDALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPEGAGAMSPTCQK
LSPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPELPL
PFTPTPGSLPGNAAPPKGEELVEAAKRNDFCKLQELHQAGGDLMHRDGQSRTLLHHAVST
GSKEVVRYLLDHAPQEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQGDT
PRQRAEKAQDTELAAYLENRQHFQMVQREDQKRLC
Download sequence
Identical sequences G1PEN7
ENSMLUP00000008988 ENSMLUP00000008988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]