SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009012 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009012
Domain Number 1 Region: 601-713
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000315
Family Pleckstrin-homology domain (PH domain) 0.046
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009012
Domain Number - Region: 980-1051
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00628
Family Regulator of chromosome condensation RCC1 0.026
Further Details:      
 
Domain Number - Region: 237-327
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.0575
Family Regulator of chromosome condensation RCC1 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009012   Gene: ENSMLUG00000009865   Transcript: ENSMLUT00000009885
Sequence length 1171
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429975:1700038:1722234:1 gene:ENSMLUG00000009865 transcript:ENSMLUT00000009885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSALWAVDLFGRVYTLSTAGQYWELCKDTQLEFKRVSAATQGCWGIACDNQVYVYVCA
SDVPIRCQEEAYENQRWNPVGGFCEKLLPSDRWPWSDVSGLQHRPLDGVALPSPHWEWES
DWYVDENFGGEPTEKGGWTYAMDFPATYTRDKKWNSYVRRRRWIRYRRYKSRDTWAKLAK
FAITKMKNDEWIDGCMGEWKDSRERSPPLALWALVSQSQVWYREDVSHPNPEGSSWSHVD
TPGEVVQISCGPHDLLWVTLWEGQALVREGINRNNPKGSSWCLVEPPTSENGIMHISVGV
GVVWAVTKDRKVWFRRGVNSHNPRGTSWIEMVGEMTMVDVGLNDQVWGIGYEDRAVYFRQ
GITPSELSGKMWKAIVASRVCDRSHSGSSSSLLRAGCFFGDEVRVSGDSCAPSDTDASSE
AERPGPEPVPAESPESPGNSKGSSASGPGTTRTAEHASEGASPADQTPGPEPRPGPASTP
AELPWTSIDLKEPKKAPSHSAETTGLSSLEMLPLGLEEPYCADDHPLWVWVSGGGCAVEA
HTVLKWFTAQAGLSSSMQTLSLSITPAQTAAWRKQIFQQLTERTKRELENFRHYEQAVEQ
SVWVKTGALQWWCDWKPHKWVDVRVALEQFTGHDGARDSILFIYYVVHEEKKYLHVFLNE
VTTLVPVLNEDKHSFALYTPERTRQRWPVRLATATEQDMNDWLALLNLSCCESRRVLGRP
SLQAIWSITCKGDIFVSEPSPDLEAPEHPLPCDQMFWRQMGGHLRVVEASSRGVVWGIGY
DGTAWVYTGGYGGGCFQGLASSTGNIYPQSDVKCVYIYENQRWNPVTGYTSSRGLPTDRY
MWSDATGLQECTKAGTKPPSLQWSWVSDWSVDFSVPGGTDEGWQYASDFPSSYHGYKTMR
DFVRRRCWARKCKLVTSGPWLEVPPIALRDVSIIPESPGADESGHSIALWAVSDKGDVLC
RVGVSELNPAGASWLHVGTDQPFASVSIGGYCQVWAVARDGSAFYRGSVSPSKPAGDCWY
HIPSPAKQRLKQVSVGQTSVYAVDDNGNLWYRQGVTPSYPQGSSWEHVSNNVRRVSVGPL
DQVWVIANKVQGSHSLSQGTVCHRTGVQPLEPKGQGWDYGIGGGWDHISIRANATRAPRS
ASQETAGEQGLPSGPSSVAGALQEAVGPVCC
Download sequence
Identical sequences G1PER0
ENSMLUP00000009012 ENSMLUP00000009012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]