SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009033 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009033
Domain Number 1 Region: 336-629
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.9e-70
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 71-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.86e-16
Family LIM domain 0.00065
Further Details:      
 
Domain Number 3 Region: 128-160
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000257
Family LIM domain 0.00073
Further Details:      
 
Domain Number 4 Region: 182-274
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000421
Family PDZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009033   Gene: ENSMLUG00000009892   Transcript: ENSMLUT00000009907
Sequence length 670
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430461:47339:72487:1 gene:ENSMLUG00000009892 transcript:ENSMLUT00000009907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFSCSGGRGERWAAGPQPEVPGAPGLSWWPTAAGLRRSQTGLQLSLFVWCGKKMGSYLSI
SAYFTSRDPFRCSECQESLTNWYYEKDGKLYCHKDYWRKFGEFCHGCSLLMTGPVMVAGE
FKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTESVQDQLPY
SVTHISMPATTESRRGFSVSVESACSNYATSVQVKEVNRMHISPNNRNAIHPGDRILEIN
GTPVRTLRVEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLDARLSPHLQNAGHSHTLST
LDIKENLEGTLRRRSLRRSNSISKSPGPSSPKEPLLFSRDISRSESLRCSSSYSQQIFRP
CDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMRSLDHPNV
LKFIGVLYKDKKLNLLTEYIEGGTLKDFVRSVDPLPWQQKVRFAKGIASGMAYLHSMCII
HRDLNSHNCLIKLDKTVVVADFGLSRLIVEERKKPPVEKATSKKRTLRKNDRKKRYTVVG
NPYWMAPEMLNGKSYDETVDVFSFGIVLCEIIGQVYADPDCLPRTLDYGLNVKLFWEKFV
PTDCPPAFFPLATICCKLEPESRPAFSKLEDSFEALSLYLGELGIPLPAELEELDHTVSV
QYGLIRDSPP
Download sequence
Identical sequences G1PET0
ENSMLUP00000009033 ENSMLUP00000009033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]