SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009040 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009040
Domain Number 1 Region: 268-382
Classification Level Classification E-value
Superfamily PH domain-like 5.13e-32
Family Pleckstrin-homology domain (PH domain) 0.0000758
Further Details:      
 
Domain Number 2 Region: 517-614
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-24
Family SH2 domain 0.0000144
Further Details:      
 
Domain Number 3 Region: 24-83
Classification Level Classification E-value
Superfamily Phenylalanine zipper 6.28e-22
Family Adapter protein APS, dimerisation domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009040   Gene: ENSMLUG00000009913   Transcript: ENSMLUT00000009915
Sequence length 758
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430445:174830:182780:-1 gene:ENSMLUG00000009913 transcript:ENSMLUT00000009915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGAPSLEDGAFPSPPPLPPPPPPSWREFCESHARAAALDFARRFRLYLASHPQYAGPGA
EAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGVEIPPHDLSLESCRVGGPLAVL
GPSRSSEDLAGPLPSSVSSSSTTSSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPP
SPAGPLETSSGPPVLGGNSNSNSSGGAGTAGRGLVSDGTSPGDRWTHRFERLRLSRGGGT
VRDGAGMVQREELLSFMGAEEAAPDPAGVGRGGGAAGPTSGGGGQPQWQKCRLLLRSEGE
GGGGSRLEFFVPPKASRPRLSIPCSTITDVRATTALEMPDRENTFVVKVEGSSEYILETA
DALHVKAWVSDIQECLSPGPCPATSPHPMTLPLAPGASFLTRENTDGLELPCLNHSESLP
SQDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIE
EEPPAGTVHPLSTPYPPLDTPETATGSFLFQGESEGGEGEQPLSGYPWFHGMLSRLKAAQ
LVLAGGTDSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFD
MLKHFRVHPIPLESGGPSDVVLGSYVVSSQRQQEPNTSHDPPPPPEPPSWTDPPHPGAEE
ASGMSEVAAATATAAKERQEKEKVGSGGVQEELVPVVELVPMVELEEAVTPGVELQGGPG
SGGVPEATPMVQLQQLPLGGDGEEGGHPRAINNQYSFV
Download sequence
Identical sequences G1PET6
XP_006105430.1.53796 XP_014303028.1.53796 ENSMLUP00000009040 ENSMLUP00000009040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]