SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009051 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009051
Domain Number 1 Region: 56-462
Classification Level Classification E-value
Superfamily Ras GEF 1.83e-79
Family Ras GEF 0.0019
Further Details:      
 
Domain Number 2 Region: 530-594
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.48e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009051
Domain Number - Region: 470-506
Classification Level Classification E-value
Superfamily EF-hand 0.00178
Family Calmodulin-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009051   Gene: ENSMLUG00000009914   Transcript: ENSMLUT00000009928
Sequence length 675
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429952:1139326:1151571:-1 gene:ENSMLUG00000009914 transcript:ENSMLUT00000009928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRKDSKRKSHQECPGKTGGRGRPRQARRHKTCPSPREISKVMASMALDMLKEGGCSEDE
LLEKCIQSFDSAGSLRRGDHILNMVLAMHSWVLPSDHLAARLLTLYPPRAIGRNTQELRR
LQICHLVRYWLTQHPETVHQEPQLEEVIGRFWATVDQEGNSAQRSLGDSSNLLSPGGPGP
PPSISSPGLGKKCKVSLLFDHLEAGELAQHLTYLEFRSFQAIKPQDLRDYVLQGSVRGCS
ALEGSVGLSNSVSRWVQVMVLSRPGPTQRAQVLDNDYILSPQSLHQLQNFNTLMAVTGGL
CHSAISRLKDSHAHLSPDSTKALLELTELLAAHNNYACYRRAWAGCMGFRLPVLGVHLKD
LVSLHEAQPDRLPDGRLHLPKLNSLYLRLQELAALQKQHPPCSANEDLLHLLTLSLDLFY
TEDEIYELSYTREPRCPKSLPSSPFKPPLVVEWAPGVMPKPDRATLGLHVEQLVESVFKN
YDPEGRGTISLEDFERLSGNFPFACHGLHPPPGQESGSFSREELTGYLLRASAICSKLGL
AFLHTFHEVTFRKPTFCDSCSGFLWGVTKQGYRCRDCGLCCHKHCRDRVKEECRKPGPKG
DMSPPGAPVLPTPTPRASCGSEDSLSYTYALEPETECHLHHAWTQTEPPHPSWEPDTVPL
PTMASPPIQSSKPNS
Download sequence
Identical sequences G1PEU7
ENSMLUP00000009051 ENSMLUP00000009051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]