SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009099 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009099
Domain Number 1 Region: 432-485
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000171
Family RING finger domain, C3HC4 0.0091
Further Details:      
 
Domain Number 2 Region: 352-417
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000262
Family IBR domain 0.019
Further Details:      
 
Domain Number 3 Region: 50-129
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000391
Family Ubiquitin-related 0.0096
Further Details:      
 
Domain Number 4 Region: 280-323
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000243
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 5 Region: 191-219
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 0.0000000377
Family Ran binding protein zinc finger-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009099   Gene: ENSMLUG00000009983   Transcript: ENSMLUT00000009979
Sequence length 509
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429827:1591943:1605021:-1 gene:ENSMLUG00000009983 transcript:ENSMLUT00000009979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSEKTSQTEEMALRLSRAVAGGDEQVAMECATWLAEQRVPLRVQLKPEISPTQDIRLWVS
VEDAQLHTVTIWLTVRPDMTVASLKDMVFLDYGFPPALQQWVIGQRLARDQETLHSHGVR
RDGDRAYLYLLSACNTSLNPQELQRQRQLRVLEDLGFKDLALQPRGPQEPALPKPGAPQE
PGQGPDTIPEPPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQVPATYQPDAEERARLA
SEEEALRQYQQRKQQQQEGNYLQHIQLDQRSLVLNTEPAECPVCYSVLAPGEAVVLRECL
HAFCRECLQGTIRNSQEAEVACPFIDNTYSCSGKLLEREIRALLTPEDYQRFLDLGVSIA
ENRSAFSYHCKTPDCKGWCFFEDDVNEFTCPVCFRVNCLLCKAIHEQMNCREYQDDLALR
AQNDVAARQTTEMLRSMLQQGEAMHCPQCQIVVQKKDGCDWIRCTVCQTEICWVTKGPRW
GPGGPGDTSGGCRCRVNGIPCHPSCQNCH
Download sequence
Identical sequences G1PEY6
ENSMLUP00000009099 ENSMLUP00000009099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]