SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009136 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009136
Domain Number 1 Region: 30-235
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.65e-62
Family BAR domain 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009136   Gene: ENSMLUG00000010014   Transcript: ENSMLUT00000010024
Sequence length 566
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429927:177885:208380:-1 gene:ENSMLUG00000010014 transcript:ENSMLUT00000010024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGKAGGAAGLFAKQVQKKFSRAQEKVLQKLGKTVETKDERFEQSANNFYQQQAEGLKL
YKELKNFLSAVKVMHESSKRVSETLQEIYSSEWDGHEELKAIVGNNDLLWEDYEEKLADQ
ALRTMENYVAQFGEIKERIAKRGRKLVDYDSARHHLEAVQNAKKKDEAKIAKADEEFNKA
QLVFEDLNQELLEELPVLYNSRIGCYVTIFQNISNLKDVFYREMSKLNHNLYEVMSKLEK
QHSNKVFVVKGLSSSSRRSLVISSPVRTSTVSSPPTSPTSPSTLSLTSERESISASEEEL
TSDPAQGEDNSEIKEEPLKEKEIEKEEAEANSSEEEQPLPACNGPTQAQPSSPQPTEGGE
SQEEVFSSSPDPSPGSALIPSEQPASLPEVVLRTRTSSEGSKQLKKRTPVQRTSAPPNRP
PPPRGTPSSRTPSGNIPSSPAASEPGSPTSPRASLGTGPPSPSSRATFEIPLDPPQKPVR
TEDKEKENTDNLNPDLCTSPTSVTPQGFSESDKASKMEDKEENKLILADSPESQGLRRRA
SVVPEDSNIAAPELQEEVSTIQSAQL
Download sequence
Identical sequences G1PF15
XP_006095725.1.53796 ENSMLUP00000009136 ENSMLUP00000009136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]