SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009152 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009152
Domain Number 1 Region: 1808-2104
Classification Level Classification E-value
Superfamily BEACH domain 6.41e-124
Family BEACH domain 0.0000000102
Further Details:      
 
Domain Number 2 Region: 2215-2474
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.13e-28
Family WD40-repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 1677-1762
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-20
Family PreBEACH PH-like domain 0.0045
Further Details:      
 
Domain Number 4 Region: 588-734
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000343
Family Laminin G-like module 0.039
Further Details:      
 
Domain Number 5 Region: 57-113,324-345,378-422,468-507
Classification Level Classification E-value
Superfamily ARM repeat 0.000023
Family HspBP1 domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009152   Gene: ENSMLUG00000009943   Transcript: ENSMLUT00000010043
Sequence length 2506
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430666:235813:262183:1 gene:ENSMLUG00000009943 transcript:ENSMLUT00000010043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASERLYELWLRYYTQKDLGSLQQWLKAYVDAFERSISLSSLEPRRPEEAGAEVPPPPP
PDALPVLAEQLDQGDLEQTLLLLKLFVLLCRNLENVEAGWGQVLVPRVLALLTRLVAKLK
GRSPLPLPEGPGPELEEVVALQALLLCEGLFDPYQTWRRQHRGEVISAKEKSKYKFPPAA
LPAEFGAFFAESLQEAERLPPTLLLRLIHLFGAVLAGGKENGQLALSAGSVQGLLGVVQG
WGRGPAQDSRLLALALEALVGAVHVLHASRTPHRGPELHALLEGYFRVLNADGPAGPSPG
PEEALIRRRVSMLDAIPRMLACEDRPVLQATFLSNNCFEHLIRLIQNSKLYLQARAPPEG
DSDLATRLLTEPDVQKVLDQDTDAIAVHVVKVLTCVMSGSPSAKEVFKERIGYPHLHEVL
QSHGPPTHRLLQELLNMAVEGDHSTCPPPPVRNEQPVLVLTRWLPALPTAELRLFLAQRL
WRLCDSCPASRATCVQAGLVSCLLETLGTGVALGTRCREQLLALLQALGRVSLRPLELRR
LLRPPPGLDSGPGGAEAARARHAGAVIRALSGMARHRGPARALHYFDLTPGMAGVMVPPV
QRWPGTGFTFHAWLCLHPPAAAPAPAPARRLQRKQLYSFFTSSGSGFEAFFTAAGTLVVA
VCTRKEYLTVSLPEVSFADSAWHCVAVVHMPGGLFSQNLVHIYKDGHLVKTAPLRCPCLT
EPFSSCCIGSAGHRTTTTTTGLPAPAGPTALAPTHPSLTRSQSVPATAGLGWGSGLGAPP
PEGSISSTLAGTQDTRWGSPTSLEGELGAVAIFHEALPTATLQALCSLGPNETAPFKPEG
DLHELGAKLLLHYSPQACKNNICLDLSPGHGLDGRLTGHRVETWDVKDVVTCVGGMGALL
PLLERVAAQPQEAEAGPAETHDLVGPELTSSHNTQGLTLPLGMSPATEERMERNAVAAFL
LMLRNFLQGHPVNQESLVQCQGPAILGALLRPVPGWAMDMNVLKSAQLLMEQVAAEGSGP
LLYPLYHHLLFNFHLWTLSDFAVCLGHIQYMASVIRKHRQKLQKKYGVQFILDALHTHYS
SQRECPLAADELRMVQTALLELLAPSSLAEDLQVVLSFLAAAGDAGQVLGALNVLLALLQ
GPAAPFVAGFLLEPGNLEVLLALLVRPWSLPQLPRRICKVLRRLQQMEHLLEPSRQRLRL
RECGLQGLVACLPEGAVSLQLCRGLYKLFLGTDCLSLSDLMAVVQLSLQADLGVRLDICR
KLFHLFYGQPDVVRLLARQAGWQDVLTRLYVLEAATAGSPLPSPSELPASPEPASPKPLT
ESPEPSDVFLPSEAPCPDPDAFYQALSPFCTPLDLGLERSSVDSGNIAGGGSGGSGTLTP
ASQPGTPSPLDGPRPFPAAQGRHSSSLSNVLGDGSLPEPTASGDDTSNTSNPQVRRAPPP
LCGTGRDTSRHREGVASGLQLPVGSQHRAGLSRVRGQPYGSCLVLLGLGFGLCLFYGILQ
SIPETLLXSCSNNQQDQKQTYRYYSASVLEAVQRHARPRACSTSAVQKLQAAQLFTAQLH
WGALWRASSPIPAEAWALRDPPAPRWKMSRAETYSRMRLKLVPNHHFNAHLEASALRDNL
GEAPLTPTEEAALPLAVTKEAKVSSVPEELPEDQLGEEELASLETAMEAAELDEQHEKLV
LSAECQLVTVVAVVPGLLEVTTQHIYFYDGSAERVETEEGVGHDFRRPLAQLREVYLRRF
NLRRSALELFFIDQANYFLNFPCKVGGTAASSPCQAPRPPPGSVPPHTQMRNQVYKWLLR
LRPPAQGYLSSRSPQEMLRASGLTQKWVQREISNFEYLMQLNTIAGRTYNDLSQYPVFPW
VLQDYVSPTLDLSNPAVFRDLSKPIGVVNPKHAQLVREKYESFEDPAGTIDKFHYGTHYS
NAAGVMHYLIRMEPFTSLHVQLQSGRFDCSDRQFHSVAAAWQARLDSLADVKELIPEFFY
FPDFLENQNGFDLGCLQLTNEKVGDVVLPPWAKSPEDFIQQHRQALESEYVSTHLHEWID
LIFGYKQRGPAAEEALNIFYYCTYEGAVDLDQVTDERERKALEGIISNFGQTPCQLLKEP
HPARLSAEEAAQRLARLDTNSPSVFQHLDQLRAFFAELISDGVPLVLALVPHRQLHSSMT
PDLLVTVSANGLLGTHSWLPYDRNISNYFRFIKDSTKGQRLLSGPWVPGSGVSGQALAVA
PDGKLLFSGGHWDGSLCVTALPRGKLLSQINRHLDIVTCLALDTCGIYLISGSRDTTCMV
WQLLYQGGLSVGLASKPIQVLYGHEAAVSCVAISTELDMAVSGSEDGAVIIHTVRRGQFV
AALRPPGAMLPGPVSHLALGSEGQIVVQSSARERLGAQVAYSLHLYSVNGRLRASLPLVE
QPTALAVTEDFVLLGTAQCALHILHLNKLLPAAPPLPMKVPIRSMAVTRERSHVLVGLED
GKLIVVGAGQPAKVRSSQFARKFWGSSRRISQVSSGETEYKPEEER
Download sequence
Identical sequences G1PF30
ENSMLUP00000009152 ENSMLUP00000009152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]