SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009153 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009153
Domain Number 1 Region: 48-405
Classification Level Classification E-value
Superfamily ARM repeat 3.26e-107
Family Diap1 N-terninal region-like 0.0000000134
Further Details:      
 
Domain Number 2 Region: 508-517,568-945
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.24e-104
Family Formin homology 2 domain (FH2 domain) 0.00000000365
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009153
Domain Number - Region: 437-497
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00293
Family Arfaptin, Rac-binding fragment 0.042
Further Details:      
 
Domain Number - Region: 500-548
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0107
Family beta-sandwich domain of Sec23/24 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009153   Gene: ENSMLUG00000010018   Transcript: ENSMLUT00000010044
Sequence length 973
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429841:1143498:1447021:1 gene:ENSMLUG00000010018 transcript:ENSMLUT00000010044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDRFASIKIPGSKKERPPLSNLKTAFASSDCSSEAMENLPKPLSEKEVLELFEKMMEDMN
LNEDKKAPLREKDFSIKKEMVMQYINTASKTGSLKRNRQISPQEFIHELKMGPADERLVT
CLESLRVSLTSNPVSWVESFGREGLGLLLDILEKLISSKIQETIVKKNQHRVIQCLKALM
NTQYGLERIMSEERSLSLLARAIDPQQPSVMTDVVKLLSAVCIVGEESILEDVLEALTSA
GEERRIDRFSSIVEGLRHNSVQLQVACMQLINALITSPDDLDFRLHIRNEFMRCGLKEIL
PNLKCIKNDGLDIQLKVFDEHKEEDLIEFSHRLQDIKAELEYPYDVYNMVWNTVKETRAE
KYFISILQHLLLIRNDCFIRQQYFKLIDECVSQIVLHRDGMDPDFTYRKRLDLDLSQFVD
ICTDQMKVEESEEKASEFYKKFEKEFTDHQETQAQLQKKEAKINELQAELQAFKSQFGAL
PADIKTSLPRAQENETGHPALPPPMAPPPPPPPPPPPPLPGMPLPFGGPVPPPPPLGFLS
GGNSLPPTLPFGLKPKKEFKPEISMRRLNWLKIRPHEMTENCFWIKANENKYENVDLLCK
LENTFCCQQKERREEEDFEEKKALKKKIKELKFLDSKVAQNLSIFLSSFRVPYEEIKMMI
LEVDETQLAESMIQNLLKHLPDQEQLNSLSQFKSDYNNLSEPEQFAVVMSNVKRLRPRLS
AILFKLQFEEQVNNIKPDIMAVSTACEEIKKSKSFSKLLELVLLMGNYMNAGSRNAQTFG
FNLSSLCKLKDTKSADQKTTLLHFLVEICEEKYPDILSFVEDLQHLDKASKVSVEMLEKN
LKQMGRQLQQLERDLETFPPPEDVRDKFVTKMSIFVISTKEQYENLSKLHENMEKLYQSI
MEYYAVDVKKVSVEDFLTDLNNFRATFMQALKENVKKREAEEKQKRVRIAQELAEKERLE
RQQKKKRLLEMKT
Download sequence
Identical sequences G1PF31
ENSMLUP00000009153 ENSMLUP00000009153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]