SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009169 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009169
Domain Number 1 Region: 11-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-67
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 316-384
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000235
Family Ubiquitin-related 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009169   Gene: ENSMLUG00000010048   Transcript: ENSMLUT00000010060
Sequence length 756
Comment pep:novel scaffold:Myoluc2.0:GL429961:1749726:1800838:-1 gene:ENSMLUG00000010048 transcript:ENSMLUT00000010060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWSPSLPTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCL
EIQIMRRLNHPNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREG
AILTLLSDIASALRYLHENRIIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCT
SFVGTLQYLAPELLEQQKYTVTVDYWSFGTLAFECITGFRPFLPNWQPVQWHSKVRQKSE
MDIVVFEDLNGAVKFSSSLPYPNNLNSILLQRLEKWLQLMLMWHPRQRGTDPAYGPNGCF
KALDDILNLKLVHILNMVTGTIHTYPVSEDESLQSLKARIRQDTGIPEEDQELLQEAGLA
LISDKPATQCISDGKLNEGHTLDMDLVFLFDNSKVTYETQISPRPQPESVSCILQEPKRN
LPFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLK
AKLDFFKTSIQIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKHLVERMMAL
QTDIVDLQRSPMGRKQGGTLDDLEEEARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQA
FEKKVRVIYTQLSKTVVCKQKALELLPKVEEVVSLMNEDEKTVVRLQEKRQKELWNLLKI
ACSKVRGPVSGSPDSMNASRLSHSGQLMSQPLTAPDSLPELVNKSEELMAEAHNLCTQLE
SAMQDTMKEQDRSLRSLDWSWLQMEEEEQNSWEQVS
Download sequence
Identical sequences G1PF44
ENSMLUP00000009169 XP_006097115.1.53796 ENSMLUP00000009169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]