SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009209 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009209
Domain Number 1 Region: 24-303
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.12e-81
Family Ankyrin repeat 0.00000000167
Further Details:      
 
Domain Number 2 Region: 370-585
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-26
Family Protein kinases, catalytic subunit 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009209
Domain Number - Region: 636-686
Classification Level Classification E-value
Superfamily PUG domain-like 0.0275
Family PUG domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009209   Gene: ENSMLUG00000010098   Transcript: ENSMLUT00000010101
Sequence length 743
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429821:6407206:6416206:-1 gene:ENSMLUG00000010098 transcript:ENSMLUT00000010101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKSHNNPQDRPTPSGNGGTSGDNNHLLIKAVKQEDMELVKQLLEGGADVNFQEEEWGW
SPLHNAVQMDNEDIVELLLRYGANPCLRKRNGATPFIVAGIVGNVRLLKLFLSKGADINE
RDLHGFTAFMEAAVYGKVEALRFLYENGAEVNLGRKTMEDQERLKKGGATALMDAAKYGQ
VDVLRILLEEMEADVRARDNMGRNALIHALARSDDSNVVAITRLLLHHGADVNVSGEGGK
TPLILAVEKKHLTLVQMFLEQKHIEIDDTDREGKTALLWAVELNLKEIAELLCGKGASTD
CGNLVMLARRHYNSSLVKLLLHHGAREDYHPPAGDWEPQSSHWGPALKHLHRIYRPMIGR
LKIFRDEEYKIADSSEGGIYLGFYDEQEVAVKRFSEDSSHGQREISCLQSIRGKSNLVTI
YGHEIHKGCLYVCISLCEQTLEGHLAERRGEAVENEEDEFGRNILLSIFKAVECILSCGY
THQDLQPQNILIDSKKAVRVADFDKSIKWAGEPEQVKSDLEALGRLVLYVVRKGDIPFEM
LKTQSNEEVITLSPNEEIQDLLQQLFWPGGNVENLLSDLLGHPFFWSWESRYRTLRDVGN
ESDIKTKIQSQELSILQLLRPRPSEPSRSFDKWTSEIDKRIMKRMQWFYRKNPDLKYEDT
VGDLLRFIRNLGEHINEEKNRWMKLKIQDPSRYFQEKFPDLIIYIYKRLQNTEYAKHFPQ
IHNAHRPQCDEGNGGQQLNQPGC
Download sequence
Identical sequences G1PF81
ENSMLUP00000009209 ENSMLUP00000009209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]