SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009211 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009211
Domain Number 1 Region: 10-227
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.56e-76
Family STAT DNA-binding domain 0.000000453
Further Details:      
 
Domain Number 2 Region: 782-989
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.3e-76
Family STAT DNA-binding domain 0.00000000922
Further Details:      
 
Domain Number 3 Region: 601-782
Classification Level Classification E-value
Superfamily STAT 1.8e-61
Family STAT 0.0000000229
Further Details:      
 
Domain Number 4 Region: 468-588
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 7.19e-44
Family Transcription factor STAT-4 N-domain 0.000017
Further Details:      
 
Domain Number 5 Region: 990-1130
Classification Level Classification E-value
Superfamily SH2 domain 2.96e-43
Family SH2 domain 0.000000146
Further Details:      
 
Domain Number 6 Region: 228-343
Classification Level Classification E-value
Superfamily SH2 domain 2.69e-40
Family SH2 domain 0.00000444
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009211   Gene: ENSMLUG00000010083   Transcript: ENSMLUT00000010103
Sequence length 1171
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429770:334996:394159:-1 gene:ENSMLUG00000010083 transcript:ENSMLUT00000010103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTYEGDPIPLQRPHLLERVTFLICSIFKKLLIKLPELNYQVKVKASIDNNRRFVLCGTHV
KAMSIEESSNGSLSVEFRHLGCHMVTEELHSITFEAQICLYGLTIDLETSSLPVVMISNV
SQLPNAWASIIWYNVSTNDSQNLVFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLNM
LAEKLTAQSSYSDGHLTWSKFCKEHLPGKSFTFWTWLEAILDLIKKHILPLWIDGCVMGF
VSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHAESGEVRFHSVEPYNKGRLSALP
FADILRDYKVIMAENVPENPLKYLYPDIPKDKAFGKHYSSQPCEAFPRKHVGRLFPGARP
SRRAGPLPWEPPAPRPASRRPAPPSPRPSSAPGNTDFKGVPERLGCNCNRGNFYICLQHR
VGPVFSILQGPRSNKVNLSCFAFICLCVSWKRKKILTPKRGRLLSSRMSQWYELQQLDAK
FLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATILFHDLLSQLDDQYSRFSL
ENNFLLQHNIRKSKRNLQDNFQEDPILMSMIIYNCLKEERKILENAQRFNQAQSGSIQGT
VMLDKQKELDARVRAVKDKVMCIEQEIKTLEDLQDEYDFKCKTSQNREHEANGVAKSDQK
QEQMLLQKMYLMLDNKRKEVVHKIIEVLNATELTQKALINDELVEWKRRQQSACIGGPPN
ACLDQLQSWFTVIAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQALSDRTFSLFQQLI
QRLLVKLQELNYNLKVKVLFDKDVNERNTVKGSKPFSYLCPLLSRFRKFNILGTHTKVMN
MEESTNGSLAAEFRHLQLKEQKNAGNRTNETTSLPVVVISNVSQLPSGWASILWYNMLVT
EPRNLSFFLNPPCARWAQLSEVLSWQFSSVTKRGLNGDQLAMLGEKLLGPGAGPDGLIPW
TRFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTF
LLRFSESCREGAITFTWVERPQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENI
PENPLKYLYPNIDKDHAFGKYYSRPKEAAEPMEVDGPKGTGYIKTELISVSEVHPSRLQT
TDNLLPMSPEEFDEVSRIVGPVEFDSMVSAR
Download sequence
Identical sequences G1PF83
ENSMLUP00000009211 ENSMLUP00000009211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]