SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009277 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009277
Domain Number 1 Region: 96-220
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.42e-23
Family cAMP-binding domain 0.0026
Further Details:      
 
Domain Number 2 Region: 228-295,410-433
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000768
Family cAMP-binding domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009277   Gene: ENSMLUG00000010176   Transcript: ENSMLUT00000010180
Sequence length 583
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429827:5616142:5666073:1 gene:ENSMLUG00000010176 transcript:ENSMLUT00000010180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKYILSHTWQLLKKEQGMYRLILDIILMIRVCKMFRQGLRGFREYQITETARRRHPIFS
FWDKKKQGRITFDTMDFVAESGYFPPRAIEIAQKIPSWRTEQDVQALCNFLQVLDCYRNY
SEALQLLLARVLRFERFGRRRVIIKKGKKSTSFYFIYLGKVAVTQDEDGSSAFLDPHPML
LQKGDCFGEMGLLSSSVRRATVVCMEETEFLVVDQDDFLANNLDHEVKKDAQDRFEFFRQ
MELLQSWSDEKLWKLVTLGKVEKYSFGQLVSKDIIESSSVMFVCRGSCEVLRLLDLAASP
FYHKWIWQHLELIDDRALKTNLKEASPVKRFKDFQIKSYPVQDFSALKLLHFQKALEQQG
TSFSKKINTLEDSLPKTFGPKIKSQQPQLLNCPMIKTKYGDIPKEALVGGYVKLHTVEEG
EIIGLHQILLPDDQQDLRPLILVSLGVELITVQKEKFCELIDCKVAEKLSRFKIGYPSDD
DMCQKFLMENSWNIFRKDLIHLLEEPRRCPPLPPIQYKKKEIYNPKSLTLDLCNFNKKTK
PNYPIFMAPRKNLPPLRIVQAIKAPRYKIQELLPRYKNAGVLV
Download sequence
Identical sequences G1PFD5
ENSMLUP00000009277 XP_006089544.1.53796 ENSMLUP00000009277

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]