SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009286 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009286
Domain Number 1 Region: 116-178
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000305
Family B-box zinc-binding domain 0.00014
Further Details:      
 
Domain Number 2 Region: 19-61
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000309
Family RING finger domain, C3HC4 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009286   Gene: ENSMLUG00000010188   Transcript: ENSMLUT00000010189
Sequence length 559
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429844:2352521:2391849:-1 gene:ENSMLUG00000010188 transcript:ENSMLUT00000010189 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSASLNYKSFSKEQQTMDNLEKQLICPICLEMFTKPVVILPCQHNLCRKCASDIFQVDFS
NTYQQPQSLDKIYKNSRFLCELATSTPPTILTRGSLKHYNLLVHLLSSIYKSDAPLPEKK
SDQPRCEEHEEERINIYCLNCEVPTCSLCKIFGAHKDCQVAPLTHVFQRQKSELSDGIAV
LVGSNDRVQGVISQLEDTCKTIEECCKKQKQELCEKFDYLYGILEERKNEMTQVITRTQG
EKLEHVRALIKKYSDHLENVSKLVESGIQFMDEPEMAVFLQNAKTLLQKISEASKAFQME
KIEHGYENMNHFTVNLNREEKIIREIDFYREDEEEEEEGEGEGGEEEGGGDREEEGQEEE
EEVKMEEVEHVGTEPSEEDESLEKALEPSQLASEVQAAPATLPVSSPEPSPALPPAADAP
VTQGEVVSTGSLQTTESETPVPTATDTADPLLYPSWYKGQTRKATTNPPSTPVSEGLGHI
GPPGSEDSSVQKAEVAEAAASERAAVSGKETSSPAATSQIGFEDPPLQGQAAASGSGNGA
DSEPARHIFSFSWLNSLNE
Download sequence
Identical sequences G1PFE3
ENSMLUP00000009286 ENSMLUP00000009286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]