SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009304 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009304
Domain Number 1 Region: 250-307,350-494
Classification Level Classification E-value
Superfamily PH domain-like 9.65e-33
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000107
Family SAM (sterile alpha motif) domain 0.000043
Further Details:      
 
Domain Number 3 Region: 176-278
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000131
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009304   Gene: ENSMLUG00000010184   Transcript: ENSMLUT00000010208
Sequence length 707
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430156:225187:234925:-1 gene:ENSMLUG00000010184 transcript:ENSMLUT00000010208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVETWTPGKVAAWLRGLDDSLQDYCFEDWELPGKYLLQLCPRSLEALTVRPLGHQELI
LEGVEQLRALSSGLQTENLQILTERLLEGTRVFQSLVQGRLGGCAEPPADVLSAAVELVR
EARTLLFWLNRHLFTHLNDFSACQEIGELCRKLGLALQEDCPAAERESRVLRICSHVTGI
CHSILSCSPQELLEQRAVLERVQLDDPLGLEIHTTSNCLHFVSQVGTQVPPNIQLQILPG
DEIVQVNEQVVVGWPHKNVVRELFREPAKVSLVLKKVPVPETPPQSPPQALGSPQLRVPS
LAQDPLSPRATSEDVFAFNLTSNPSPGSSPASTDSASLDPEPLPITPASPATLPAGGAET
REPLENKSPVLDRKKSKGVATRLSRRRVSCRELGQPDCDGWLLLRKVPGGFMSPRWRRCW
FVLKRHKLYWYRQPQDEKAEGLINVSNYSLESGHDQKKKYVFQLTHDVYKPFIFAADTLA
DLSMWVRHLITCISKYQSPGQAALPREEDCYSETEVEDLDDEAGSRSASPSLGQAGSPPH
GDTSPAATPTQGSPRTSFGLPTDSSEGTLEGMVRGLRQGGVSLLGQPQPLTHEQWRSSFM
RRNRDPQLNERVHRVRALQSTLKAKLQELQALEEVLDDPELTGEKFRRWKEQNQELYSEG
LGAWGVVQAESSSQVLTSGSREHSAQALSSDPEEHSHHCHLTPESNL
Download sequence
Identical sequences G1PFF6
ENSMLUP00000009304 XP_006102025.2.53796 ENSMLUP00000009304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]