SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009312 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009312
Domain Number 1 Region: 26-251
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.39e-45
Family Ankyrin repeat 0.0003
Further Details:      
 
Domain Number 2 Region: 483-579
Classification Level Classification E-value
Superfamily PDZ domain-like 5.78e-18
Family PDZ domain 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009312   Gene: ENSMLUG00000010179   Transcript: ENSMLUT00000010216
Sequence length 700
Comment pep:novel scaffold:Myoluc2.0:GL430579:50692:80867:-1 gene:ENSMLUG00000010179 transcript:ENSMLUT00000010216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EQFRYKRRVYAQNLIDDKQFAKLHTKANLKKFMDYVQLHSTDKVARLLDKGLDPNFHDPD
SGECPLSLAAQLDNAADLLKVLRNGGAHLDFRTRDGLTAVHCATRQRNAAALTTLLDLGA
SPDYKDSRGLTPLYHSALGGGDALCCELLLHDHAQLGTTDENGWQEIHQACRFGHVQHLE
HLLFYGADMGAQNASGNTALHICALYNQESCARVLLFRGANKDVRNYNSQTAFQVAIIAG
NFELAEVIKTHKDSDVVPFRETPSYAKRRRLAGPSGLASPRPLQRSASDINLKGEVQPAA
SPGPTLRSLPHQLLLQRLQEKDRDRDGDKENDVGGTEAGRGSQSNISFWKPSESGQVRGP
YEKPLAHSAGQPPLVKASLLPAPPGQEPSFPRAGRRGGAGETLLRRGEGGRALQMWLGLP
ALWAESDLGPRGWVVPELVEEIGYQKSQQLKLPSETREDRTKRLFRHYTVGSYDSLTSHS
DYVIDDKVAILQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVAWRAG
LRTGDFLIEVNGVNVVKVGHKQVVALIRQGGNRLVMKVVSVTRKPEEDGARRRAPPPPKR
APSTTLTLRSKSMTAELEELEKLDEILAAATEPALRPDIADADSRAATVKQRPTSRRITP
AEISSLFERQGLPGPEKLPGSLRKGIPRTKSVGTAGLGSA
Download sequence
Identical sequences G1PFG4
ENSMLUP00000018391 ENSMLUP00000009312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]