SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009329 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009329
Domain Number 1 Region: 1313-1421
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.16e-34
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Domain Number 2 Region: 615-729
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-33
Family Spermadhesin, CUB domain 0.00078
Further Details:      
 
Domain Number 3 Region: 1659-1778
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-31
Family Spermadhesin, CUB domain 0.00063
Further Details:      
 
Domain Number 4 Region: 451-555
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-31
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 5 Region: 70-173
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-29
Family Spermadhesin, CUB domain 0.00077
Further Details:      
 
Domain Number 6 Region: 274-383
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-28
Family Spermadhesin, CUB domain 0.00076
Further Details:      
 
Domain Number 7 Region: 1139-1247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-27
Family Spermadhesin, CUB domain 0.00084
Further Details:      
 
Domain Number 8 Region: 2009-2116
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-26
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 966-1075
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.32e-26
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 787-908
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-26
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 11 Region: 2189-2293
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-25
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 12 Region: 1481-1596
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-23
Family Spermadhesin, CUB domain 0.006
Further Details:      
 
Domain Number 13 Region: 1836-1946
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.68e-22
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 14 Region: 2922-2993
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.15e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 15 Region: 2566-2634
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-18
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 16 Region: 2982-3051
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.58e-18
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 2806-2873
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-17
Family Complement control module/SCR domain 0.00072
Further Details:      
 
Domain Number 18 Region: 2623-2690
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.85e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 3102-3170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 20 Region: 211-283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000106
Family Complement control module/SCR domain 0.00093
Further Details:      
 
Domain Number 21 Region: 1951-2019
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000796
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 22 Region: 2478-2540
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 23 Region: 2358-2424
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000229
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 24 Region: 1777-1839
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000337
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 25 Region: 2863-2927
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000347
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 26 Region: 6-67
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000351
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 27 Region: 2683-2750
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000594
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 28 Region: 2739-2799
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000876
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 29 Region: 735-795
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 30 Region: 2295-2362
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 31 Region: 1253-1316
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000025
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 32 Region: 1426-1493
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000405
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 33 Region: 3034-3096
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0007
Further Details:      
 
Domain Number 34 Region: 1078-1140
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000216
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 35 Region: 2121-2185
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000297
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 36 Region: 560-629
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000431
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 37 Region: 3157-3219
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000903
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 38 Region: 2431-2495
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000959
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 39 Region: 908-970
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000998
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 40 Region: 1603-1666
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000012
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 41 Region: 393-451
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000361
Family Complement control module/SCR domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009329   Gene: ENSMLUG00000010124   Transcript: ENSMLUT00000010236
Sequence length 3460
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429898:1994979:2346304:1 gene:ENSMLUG00000010124 transcript:ENSMLUT00000010236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPSHTCGNPGRLPNGIQQGSTFNLGDKVRYSCNPGFFLEGHAILTCHSGSESSATWDFP
LPSCRADDACGGTLRGQSGIISSPHFPAEYHNNADCTWTILAELGDTIALVFIDFQLEDG
YDFLEVTGTEGSSLWFTGASLPAPVISSKNWLRLHFTSDGNHRQRGFSAQYKVFKKQIEL
KSRGVKLMPSKDSSQKTSVLTQIGVSQGHNMCPDPGIPERGKRLGSDFRLGSSVQFTCNE
GYDLQGSKRITCMKVSDMFAAWSDHRPVCRARMCDAHLRGPSGIITSPNFPIQYDNNAHC
VWIITALNPAKVIKLAFEEFDLERGYDTLTVGDGGQDGDQKTVLYILTGTSVPDLIVSTN
HQMWLLFQTDGSGSSLGFKASYEGIDRGHKASPVAAAYGQREGSRFRHGDTLKFECQPAF
ELVGQKAITCQKNNQWSAKKPGCVFSCFFNFTSPSGVVLSPNYPEDYGNHLHCVWLILAR
PESRIHLAFNDIDVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSSGHVARLEFQTD
HSTGKRGFNITFTTFRHNECPDPGIPVNGKRFGDSLQLGSSISFLCDEGFLGTQGSETIT
CILKEGSVVWNSAVLRCEAPCGGHLTAPSGTILSPGWPGFYKDALSCAWVIEAQPGYPIK
ITFDRFKTEVNYDTLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYLLFSTDKSHSDI
GFQLRYETITLQSDHCLDPGIPVNGQRHGNDFYVGALVTFSCDSGYTLSDGEPLECEPNF
QWSRALPSCEALCGGFIQGSSGTILSPGFPDFYPNNLNCTWMIETSHGKGVFFTFHTFHL
ESGHDYLLITENGSFTQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDFSMSYEGFNITF
SEYDLEPCEEPEVPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCLGGRRRLWSSPL
PRCVAECGNSVTGTQGTLLSPNFPANYNNNHECIYSIQTQPGKGIQLKARAFELSEGDVL
KVYDGNNNSARLLGVFSRSEMMGVTLNSTSSSLWLDFITDTENTSKGFELQFSSFELIKC
EDPGTPQFGYKVHDGGQFAGSSVSFGCDPGYSLRGSEELLCLSGERRTWDRPLPTCVAEC
GGTVKGELLGQVLSPGYPAPYEHNLNCIWTIEADAGCTIGLHFLVFDTEEVHDVLRIWDG
PVESGVLLKELSGSALPKDLHSTFNSVVLQFSTDFFTSKQGFAVQFSVSTATSCNDPGVP
QNGSRSGDSWEAGDSTVFQCDPGYALQGSAEISCVKIENRFFWQPSPPTCIAPCGGDLTG
PSGVILSPNYPEPYPPGKECDWKVTVSPDYVIALVFNIFNLEPGYDFLHVYDGRDSLSPL
IGSFYGSQLPSRIESSSNSLFLAFRSDASVSNVGFVIDYTENPRESCFDPGTVKNGTRVG
SDLKLGSSITYYCHGGYEVEGSSTLSCVLGPDGKPAWNNPRPVCTAPCGGQYVGSDGVVL
SPNYPQNYTSGQICLYFVTVPKDYVVFGQFAFFHTALNDVVEVHDGHSQHSRLLSSLSGT
HTGESLPLATSNQVLIKFSAKGQAPARGFHFVYQAVPRTSATQCSSVPEPRYGKRLGSDF
SVGAIVRFECNSGYALQGSPEIECLPVPGALAQWNVSAPACVVPCGGNLTERRGTILSPG
FPEPYLNSLNCVWKIMVPEGAGIQIQVISFVTEQNWDSLEVFDGADNTVTMLGSFSGTTV
PALLNSTSNQLYLHFYSDISVSAAGFHLEYKTVGLSSCPEPAVPSNGVKTGERYLVNDVV
SFQCEPGYALQGHAHISCMPGTVRRWNYPPPLCIAQCGGAVEEMEGVILSPGFPGNYPGP
TAEGQDLSLPVGWGRAHIQFLNFSTEPNHDFIEIRNGPHETSRMMGRFSGSDLPSSLLST
SHETTVYFHSDHSQNRPGFKLEYQAYELQECPDPEPFANGIVRGAGYNVGQSVTFECLPG
YQLMGQPVLTCQHGSNRNWDHPLPRCEVPCGGNITSSNGTVYSPGFPSPYSSSQDCVWLI
TVPIGHGIHLNLSLLQTEPSGDFITVWDGPQQTAPQLGVFTRSLAKKTVHSSTNQVLLKF
HRDAATGGIFAIAFSAYPLTKCPPPTILPNAEVVTENEEFNIGDIVRYRCLPGFTLVGNE
ILTCKLGTYLQFEGPPPICEVHCPTNELLTDSTGVILSQSYPGSYPQFQTCSWLVRVEPD
YNISVTVEYFLSEKQYDEFEIFDGPSGQSPLLKALSGNYSAPLIVTSTSNSVYLRWSSDH
AYNRKGFKIRYSAPYCSLPRAPLHGFLLGQTSTQPGGSVHFGCNAGYRLVGHSMAICTRH
PQGYYLWSEAIPLCQALSCGLPEAPKNGMVFGKEYTVGTKAVYSCSEGYHLQAGAEATAE
CLETGLWSNHNVPPHCVPVTCPDVGGIGVEHGRWRLIFETQYQFQAQLMLICDPGYYYTG
QRVIRCQANGKWSLGNSMPTCQIISCGELPIPPNGHRIGTLSVYGATAIFSCNSGYTLVG
SRVRECMANGLWSGSEVRCLGTQKNENDLNSSLIYTLSLSPIKAGHCGTPEPIVNGHING
ENYNYRGSVVYQCNAGFRLIGMSVRICQQDHHWSGKTPFCVPITCGHPGNPINGLTQGNQ
FNLNDVVKFVCNPGYVSEGAAGSQCLANGQWSDTLPTCRIINCTDPGHQENSVHQVHASG
PHRFSYGTTVSYQCNHGFYLLGTPALSCQGDGTWDRPRPQCLLVSCGHPGSPPHSQMSGD
NYTVGAVVHYSCSGKRTLVGNATRVCGLDGHWTGSLPHCSGTSMGICGDPGIPAHGIRLG
ESFAPGSLMRFSCEAGHVLRGSSERTCQANGSWSGTQPECGVISCGNPGTPSNARVVFSD
GLVFSSSIVYECREGYYATGLLSRHCSVNGTWTGSDPECTVIKCGDPGVPANGLRLGSDF
RYNKTVTYQCVPGYMMESHRVSVLSCTKDRTWNGTKPVCKAIMCKPPQLIPNGKVVGSDF
MWGSSVTYACLEGYQLSLPAVLTCEGNGSWTGELPQCFPVFCGDPGVPARGRREDRGFSY
RSSVSFSCQSPLVLVGSPRRFCQSDGTWSGTQPSCIDPTLTTCADPGMPQFGIQNSSQGY
QVGSTVLFRCQKGYLLQGSTTRTCLPNLTWSGSPPDCVPHHCKQPETPTHANVGALDLPS
MGYTLIYTCQEGFSLKGGSEHRTCKADGSWTGKPPICLAEVRPSGRPINPAREPPLTQAS
VPGDVFAKNSLWKGAYEYQGKKQPAMLRVTGFQVVSSKVNATMIDHSGVELHLAGIYKKE
DFHLRLQVYQITGPVEIFVNKFKDDHWALDGHVSSESSGGTFIYQGSVKGHGFGQFGFQR
LDLRLLESDPESIGRHFASNSSSVAAAILVPFIALIIAGFVLYLYKHRRRPKVPFNGYAG
HENTNVRATFENPMYDRNIQPTDIMATEAEFTVSTVCTAV
Download sequence
Identical sequences G1PFH6
ENSMLUP00000009329 ENSMLUP00000009329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]