SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009356 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009356
Domain Number 1 Region: 403-540
Classification Level Classification E-value
Superfamily TIMP-like 2.39e-24
Family Netrin-like domain (NTR/C345C module) 0.016
Further Details:      
 
Domain Number 2 Region: 185-281
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 3 Region: 354-411
Classification Level Classification E-value
Superfamily BPTI-like 9.51e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.002
Further Details:      
 
Domain Number 4 Region: 106-156
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000236
Family Ovomucoid domain III-like 0.039
Further Details:      
 
Domain Number 5 Region: 302-350
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000199
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.022
Further Details:      
 
Domain Number 6 Region: 26-73
Classification Level Classification E-value
Superfamily Elafin-like 0.000000432
Family Elafin-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009356   Gene: ENSMLUG00000010278   Transcript: ENSMLUT00000010269
Sequence length 547
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430265:118087:120339:-1 gene:ENSMLUG00000010278 transcript:ENSMLUT00000010269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAQRLLLPLLLMVGLTSGASLLQGPRSHSGVCPNQLSPNLWVDAQSTCERECVGDQDCL
ATEKCCTNVCGLQSCVAARFPEGGLATPALVASCEGFSCPQQGSDCDIWDGQPVCRCRDR
CEKEPSFTCASDGLTYYNRCYMDAEACLRGLRLHVVPCKHILTWPPSSPGPPETTARPTP
GDTPVPPALYSSPSPQVVYVGGTASLHCDVSGRPPPAVTWEKQSEQRENLIMRPDQMYGN
VVVTSIGQLVLYNARPEDAGLYTCTARNTAGLLRADFPLSVVQRDPARDRAPSAPAECLP
QAQACASPLSSHVLWHFDPQRGGCMTFQVGSCDGGTQGFETYEECQQACARGPGDNCVLP
AVQGPCQGWEPRWAYSPLLQQCHPFVYGGCEGNSNNFESQESCEDACPVPRMPPCRACRL
RSKLALSLCRSDFAIVGRLTEVLEESEAGGGSIARVALDDVLKDDKMGLRFLGTKYLEVT
LSGMDWACPCPNVTAGDGPLVIMGEVRDGVAVLDAGSYVRIASEKRIKKISELLEKRACE
LLNRFQD
Download sequence
Identical sequences G1PFJ9
ENSMLUP00000009356 XP_006103718.1.53796 ENSMLUP00000009356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]