SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009378 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009378
Domain Number 1 Region: 976-1155
Classification Level Classification E-value
Superfamily TPR-like 0.000000000379
Family Tetratricopeptide repeat (TPR) 0.047
Further Details:      
 
Domain Number 2 Region: 739-946
Classification Level Classification E-value
Superfamily TPR-like 0.000000000778
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 
Domain Number 3 Region: 245-328
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000187
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 4 Region: 1126-1245
Classification Level Classification E-value
Superfamily TPR-like 0.000000664
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Domain Number 5 Region: 192-251
Classification Level Classification E-value
Superfamily SH3-domain 0.00000204
Family SH3-domain 0.0066
Further Details:      
 
Domain Number 6 Region: 527-659
Classification Level Classification E-value
Superfamily TPR-like 0.0000632
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009378   Gene: ENSMLUG00000010270   Transcript: ENSMLUT00000010292
Sequence length 1293
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429969:604894:653199:1 gene:ENSMLUG00000010270 transcript:ENSMLUT00000010292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGCFCIPRERSLSWGPGKETLSKDPAISSEFRSSPEDKERCFLLQNMTPDLTLSFSVKS
RSRRCVNGPLQEAARRRLWALENEDQEVRALFKDLSARLVGIQSQQAQFLITFKTVEEIW
KFSTYLSLGYVSACLEHLLFDHKYWLNCGLVEDTEVQVSVDDKHLETIFLALLTQEGHFF
CRATCAVAQPAEQEGECLTLGEGELISVKTADGGSECEGMSLVTGQRGLVPVSALEPLPL
PFHQWFLKNYPGSCGLPRKRDWTGSYQIGRGKCKAWKDYEREEKDELDLRQGESIEIVGF
VIPGLQWFIGKSACSGEVGFVPTRNIDPDSYSPTSKNSAFFSDEERCSLGVLGSDGKAES
TSFLHALAQTDITSVYRLSGFESIQNLPNDLSASQPDGFQEARPGGAREEQQASGSGRSS
SSEDCSLEELLSAASDSYHLPEPDDLDDPELLMDLNSGQEEEEAETFAPILAFLDHQGYA
DHLKSLYDFSFSFLTSSFYSFSEEDELVVYLEASRKWAKRSHMTWAHARLCFLLGRLSVR
KVKLSQARVYFEEAIRILNGAFEDLSLVAALYINVAAIYLRQRLRHKGSALLEKAGALLA
CLPDRESSAKNELDVVAYVLRQGIASGSCPLEARACFLAIRLLLSLGRHEEVLPFAERLQ
LLSGHPPASDAVATILSFLYDKKYLPHLAVASVRQRGPQSAQGMSLPVWQVHLALQNATK
LLRVPSTSWNEVSPLACPALRQALAACEEQADRRTQRALCLILSRVYLQHRSPDGAIYYL
SQALVLGQLLGEQEAFESALCLAWAYLLASQAKKALDILYPLLHSLKETEDAIQKGVVQN
LLGLALQGEGRLNRAAKSYLRALNGAQEVGDVRNQAVTLANLGHLSLKSWAQQPARDYFL
QAVRLYCQLQGSVETDMELVQVLLWLAQVLVCGCQLASGRLCYEMALLFGLRHRHLKSQL
QVTKSLCHFYSSVSPNPEACITYHEHWLALAQRLRDREMEGQLLESLGQLYRNLNTARSL
RRSLTCIKESLRIFIDLGEEGKAAEAWLGAGRLYYLMQEDELVELYLQAAIQKALKPEEP
SLALKLYEEAGDVFFNGTRHRHRAVEYYRAGAVPLARRMKAVRTELRIFNKLTELQISLE
GYDKALEFATLAARLSTVTVFRSLGDQKQELVAFHRLATVYYSLHMYEMAEDCYLKTLSL
CPAWLQTPKEALYYAKVYCRLGRLTFYQLKDAHDATEYLWLALAAAALLGDEELQDTIRS
RLDSICQSPLWLSSPSGRSAERARWLSGGGLAL
Download sequence
Identical sequences G1PFL5
ENSMLUP00000009378 ENSMLUP00000009378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]