SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009388 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009388
Domain Number 1 Region: 719-812
Classification Level Classification E-value
Superfamily PDZ domain-like 2.63e-26
Family PDZ domain 0.00028
Further Details:      
 
Domain Number 2 Region: 544-645
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-24
Family PDZ domain 0.00013
Further Details:      
 
Domain Number 3 Region: 106-209
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-23
Family PDZ domain 0.0000504
Further Details:      
 
Domain Number 4 Region: 407-518
Classification Level Classification E-value
Superfamily PDZ domain-like 5.92e-22
Family PDZ domain 0.00045
Further Details:      
 
Domain Number 5 Region: 261-370
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-17
Family PDZ domain 0.0002
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009388
Domain Number - Region: 27-54
Classification Level Classification E-value
Superfamily WW domain 0.000742
Family WW domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009388   Gene: ENSMLUG00000010296   Transcript: ENSMLUT00000010303
Sequence length 1127
Comment pep:novel scaffold:Myoluc2.0:GL431353:7702:43401:-1 gene:ENSMLUG00000010296 transcript:ENSMLUT00000010303 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FCSHNTKTTTWLDPRLCKKAKAPEDCEDGELPYGWEKIEDPQYGTYYVEFFLKEQWFCLL
SFKNPPSIYSHLNQKTQFENPVEEAKRKKQSGQADTGPSKPDTEKSHFTRDPSQLKGILV
RASLKKSTMGFGFTIIGGDRPDEFLQVKNVLKDGPAAQDGKIAPGDVIVDINGSCVLGHT
HADVVQMFQLVPVSQYVNLTLCRGYPLPDDNEDPAVDMVAATPVINGQSLTKGENTQDFK
SGAMALDQNGKPGQVLAGDRLNGPSDASEQRASMASSASSQPELVTVPLIKGPKGFGFAI
ADSPTGQKVKMILDSQWCPGLQKGDVIKEIYHQNVQNLTHLQVVEVLKQFPVGADVPLLI
LRGGPPSPTKTAKMKTDKKEHSGSLEAVNEPMPQPLPFPPSIVRSGSPKLDPSEVYLKSK
TLYEDKPPNTKDLDVFLRKQESGFGFRVLGGDGPDQAIYIGAIIPLGAAEKDGRLRAADE
LMCIDGIPVKGKSHKQVLDLMTTAARNGHVLLTVRRKIFYGEKQPEDDSAQAFLSTQNGS
PRLNRADAAARPTPPEAYEVVLQRKENEGFGFVILTSKTKPPPGVIPHKIGRVIEGSPAD
RCGKLKVGDHISAVNGQSIVDLSHDSIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQ
SPALQHRPLGQSQASHAPGDSSVQRGPWLLSRSETYRHSWADHKQLPQPDAAVISAVGSR
HHQGLGCYPVELERGPRGFGFSLRGGKEYNMGLFILRLAEDGPALKDGRIHVGDQIVEIN
GEPTQGITHTRAIELIQAGGNKVLLLLRPGTGLIPDHGDWDTSHPPSPLVIYDEQSPSAP
PSRSASMFEEPHVPVTGDSSARAQPRDQAELQDAAPGRKGTSHQSLQKNASKRDPPAGHG
HGDKKNLLKVENGVSRRGRSASPKKAASRYAEDHLETIPGPLKSDPKRRPRDRSSSPRRG
ESKSGPSSARAGPGQDPARSSRGRSSSPKKQPRTEGSRDPPGAPASEGAQPASDGVRNEA
KQGPPGKTRARSPEKRSKRLDEKSLPSKKTPLVASRGGPESEKGKRAPLGEASEKKLKPD
PEDDSGKEAADSGRGSPGRRAPITPGPWKVPSASKASGSTGVAERRL
Download sequence
Identical sequences G1PFM2
ENSMLUP00000009388 ENSMLUP00000009388

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]