SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009401 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009401
Domain Number 1 Region: 500-568
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.07e-17
Family SAM (sterile alpha motif) domain 0.001
Further Details:      
 
Domain Number 2 Region: 991-1060
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000001
Family SAM (sterile alpha motif) domain 0.0098
Further Details:      
 
Domain Number 3 Region: 417-517
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000084
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009401   Gene: ENSMLUG00000010290   Transcript: ENSMLUT00000010317
Sequence length 1067
Comment pep:novel scaffold:Myoluc2.0:GL429778:3990857:4059077:-1 gene:ENSMLUG00000010290 transcript:ENSMLUT00000010317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLHKSNSEDSAGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQ
LMMMVKEKMITIEEALARLKEYEAQHRQSTALDPADWPEGSYPTFDGSSNCNSREQSDDE
TEDSVKFKRLHKLVNSTRRVRKKLIRVDEMKKPSTEGGEEPVFESPPALDERAALYSGVH
KKPFLFDGSPEKPPEDDSDPFTTSPSPGNLEAWATGRKLVKTFSKGDSRGLIKPPKKMGT
FFSYPDEEKAQKVSRSLTEGEMRKSLGSLSHGRTCSFGGFDLTNRSLHIGSNNSYPMGKE
GDFVYKEVIKSPTASRISLGKKVKSVKETMRKRMSKKYSNSVPEQDTGLDGMPGSPPSSQ
PDSEHMDKPKLKAGGSVESLRSSLSGQSSMSGQTVSTTDSSTSNRESVKSEDGDDEEPPY
RGPFCGRARVHTDFTPSPYDTDSLKLKKGDIIDIISKPPMGTWMGLLNNKVGTFKFIYVD
VLNEEEEKPKRPTRRKRKGRPPQPKSVEDLLDRINLKEHMPTFLFNGYEDLDTFKLLEEE
DLDELNIRDPEHRAVLLTAVELLQEYDSKSPPRNSDQSGSQEKLLVDSQALSGCSPRDSG
CYESSENLENGKTRKSGLLSAKSSAESSLKSFSRNQLGTFPTLPLPKSVDALKQGVENRL
GGGLTPHSVKRCDQPCATGLNKNRRSLPVSICRSCETLEGPQPTASSIAKAHSPQGDSAV
DNALLLTQSKRFSDPQKTTTKKLGGSITAASSGMSPPPCLQNYDAQPPRHSLTRTPLEGH
RKGLALEGTYQPPNTKEGEQRGPEAVTPGRHPTQPPPVPAKKSKERLANGLHPCPPGPSA
PSLPLKKGGSSGPSDCPSPQASEPPSRQEPGSPPSSRPPPWLSELRESASLQEHGVRLGP
AVTRKISCARGVDLEMLTEDKLRAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPER
DVATNMDQIRVKLLRKQHRMAIPSGGLTEICRKPLSPGCVSSVSDWLISIGLPMYTSALT
EAGFRTLGQVPSLSHTCLQEAGITEERHISKLVSAARLFKLPPGPEA
Download sequence
Identical sequences G1PFN2
ENSMLUP00000009401 ENSMLUP00000009401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]