SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009507 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009507
Domain Number 1 Region: 640-882
Classification Level Classification E-value
Superfamily VPS9 domain 4.45e-49
Family VPS9 domain 0.00081
Further Details:      
 
Domain Number 2 Region: 61-183
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000152
Family SH2 domain 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009507   Gene: ENSMLUG00000010433   Transcript: ENSMLUT00000010432
Sequence length 1002
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430083:56680:132523:1 gene:ENSMLUG00000010433 transcript:ENSMLUT00000010432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFQSSVPTCSYSIGQHPSPEVDKREEEEEEDGMGPCPPVTPKNCLAPRGISVLEKLVKTC
PVWLQLGLGRAEAARILHREAAGTFLVRRDSCSKRLVLCVHFPSLNAGSSEVLEYTVKEE
KSILYLEGSVLVFEDIFRLIAFYCVSRRFTAFTLRLPQALEASSFTDLKTIANLGLGFWD
SSLNPRRAAGSPAEPPRDPAPRAPPASSLRSASHQENCACEIELSVGNDRLWFVNPIFIE
DCGSALPADLSPLRSCPSGPLPPTSDATSPASRWAPRRPAPPPPAPPLHPLSPARPRPPP
APAPACPLPSSPSPPDALPPASPASVPHLAPHALGPPDHPSQRPMTACERPPCTPTGLGP
LREEEMKPGAAPSPLQQAPAPPGPGKKGAPAAPPRRRLSEKLSLEDPIVEKMDRGTTAQW
DQPGLSRTPPLGLPPQGTSDSPGDRPQRTTEQGQEVVAQASQLGILPESARKIRQPPVPP
PRKKRISRQLASVLPSPLESAELSMEGAAPEKPTPGPHEEAPRPASQAGTPSPEAQASAW
RQSAPEFKGSLASLSDSTGVHTPATDQDSYSTSSTEEELEQFSSPNVKKKPSMILGKARH
RLSLASFTSVFQAFLSNDRKLYKKVVELAQDKASYFGNLVQDYKVYSLEMMARQASSTEM
LQEIRTMMTQLKSYLLQSTELKALGDHTQYSEEELEAIVESALYKCVLKPLKEAINSCLH
EIHSKDGSLQQLKENQLVILATTTTDLGVTTSVPEVPIMEKILQKFSSMHKAYSPEKKIS
ILLKTCKLIYDSMALGNPGKPYGADDFLPVLMYVLARSNLTEMLLNVEYMMELMDPALQL
GEGSYYLTTTYGALEHIKNYDKITVTRQLSVEVQDSIHRWERRRTLNKARASRSSVQDFI
CVSYLEPEQQSRTLASRADTLGTALCAQCAEKFEVLQPQDHRLFVLVDGRCFQLADEALP
HHIKGYLLRSEPKRDFHFVYRPLDGGGSGDPPCLVVREPNFL
Download sequence
Identical sequences G1PFX6
ENSMLUP00000009507 ENSMLUP00000009507

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]