SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009509 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009509
Domain Number 1 Region: 86-197,226-270
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 8.93e-26
Family AlkB-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009509   Gene: ENSMLUG00000010443   Transcript: ENSMLUT00000010434
Sequence length 298
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429812:6734954:6742211:1 gene:ENSMLUG00000010443 transcript:ENSMLUT00000010434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVVAAPEVLRECGCKGIRTCLICERQRGGDPPWQHSPQSDHSSPLGPGGSLTANLHA
ATPTPPHLPHPPLASGPGSFTGPRGNDMERVEGRWGLTTQGRVKQDYGPKVNFRKQKLKT
AGFQGLPSFSREIVRRMGLYPILEDFRPVEQCNLDYCPERGSAIDPHLDDTWLWGERLVS
LNLLSPTVLSMSREAPGSLLLCLAPSGFPEALEGVMAPSRSVLCQEVEVAVPLPRRSLLV
LTGAARHQWKHAIHRRHVEARRVCATFRELSAEFCPGGRQQELGQELLQISLSFQGRP
Download sequence
Identical sequences G1PFX8
ENSMLUP00000009509 ENSMLUP00000009509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]