SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009512 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009512
Domain Number 1 Region: 21-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.35e-70
Family FCH domain 0.0018
Further Details:      
 
Domain Number 2 Region: 355-415
Classification Level Classification E-value
Superfamily SH3-domain 2.76e-21
Family SH3-domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009512   Gene: ENSMLUG00000010432   Transcript: ENSMLUT00000010437
Sequence length 416
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429808:8093790:8117747:-1 gene:ENSMLUG00000010432 transcript:ENSMLUT00000010437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQKQPPNAGWECRDFTAHTGYEMLLQRLLDGRKMCKDMEELLRQRAQAEERYGKELVQI
ARKAGGQTEINSLRASFDSLKQQMEDIGNSHMQLALALREELRSLEDFRERQKEQRKKYE
AVMDRVQKSKLSLYKKVMESKKTYEQKCRDADDAEQAFERISISGQQKQVEKSQNKAKQC
KDSAMEAERVYRQNIEHLEKVRGEWEQEHQTTCEAFQLQEFDRLTILRNALWVHCNQLSM
QCVKDDELYEEVRVTLEGCSVEADINSFIQAKSTGTEPPAPVPYQNYYDREVTISSGSPG
IQPSCGMIKRFSGLLHGSPKTAQSAASAASTDTLTPTPNQNEGVYAAVSVQEAPGPPTLP
ARNYRVVYDYKAQNSDELDISAGDILEVILEGEDGWWTVEQNGQRGFVPGSYLEKL
Download sequence
Identical sequences G1PFY1
ENSMLUP00000009512 ENSMLUP00000009512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]