SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009538 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009538
Domain Number 1 Region: 43-261
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.47e-37
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009538   Gene: ENSMLUG00000010455   Transcript: ENSMLUT00000010465
Sequence length 263
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430265:64382:65960:1 gene:ENSMLUG00000010455 transcript:ENSMLUT00000010465 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLLVLWTLTAPARPGPGEEGDGGWQRRGAAPAAAAAAEEERCTVERRADLSYAEFVQHY
AFSRPVILQGLTDNSRFRALCSRKRLLASFGDNVIRLSTANTYSYQKVDLLFQEYVEQLH
PQDPTSLGNNTLYFFGDNNFTEWASLFRHYVPPPFGLLGTTPAYSFGIAGTGSGVPFHWH
GPGFSEVIYGRKRWFLYPPEKTPEFHPNKTTLAWLQDTYPALAPSARPLECTIQAGEVLY
FPDRWWHATLNLDTSVFISTFLS
Download sequence
Identical sequences G1PG01
ENSMLUP00000009538 ENSMLUP00000009538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]