SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009561 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009561
Domain Number 1 Region: 21-103
Classification Level Classification E-value
Superfamily Immunoglobulin 8.34e-27
Family V set domains (antibody variable domain-like) 0.0000801
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009561   Gene: ENSMLUG00000010510   Transcript: ENSMLUT00000010489
Sequence length 103
Comment pep:novel scaffold:Myoluc2.0:AAPE02063753:5382:5799:-1 gene:ENSMLUG00000010510 transcript:ENSMLUT00000010489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMAWAPLLLTLLAHCTGSWAQSVLTQPSSVSGSPGQRVTISCTGSSTNVGYGDYVSWFQQ
LPGKAPKLLIYESSKRPTGIPDRFSGSRSGSSASLTITGLQAE
Download sequence
Identical sequences L7N1K0
ENSMLUP00000009561 ENSMLUP00000009561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]