SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009616 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009616
Domain Number 1 Region: 585-773
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.03e-54
Family DBL homology domain (DH-domain) 0.00000000675
Further Details:      
 
Domain Number 2 Region: 778-918
Classification Level Classification E-value
Superfamily PH domain-like 2.55e-38
Family Pleckstrin-homology domain (PH domain) 0.000000149
Further Details:      
 
Domain Number 3 Region: 269-413
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-17
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 4 Region: 1073-1130
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000276
Family SH3-domain 0.00091
Further Details:      
 
Domain Number 5 Region: 30-182
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000209
Family CRAL/TRIO domain 0.0082
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009616
Domain Number - Region: 424-514
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000781
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009616   Gene: ENSMLUG00000010508   Transcript: ENSMLUT00000010550
Sequence length 1164
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429800:32166:84806:-1 gene:ENSMLUG00000010508 transcript:ENSMLUT00000010550 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPPSDRCVRLSALPADEIMHQDITPLCAADIQDQLRKRFAYLSGGRGQDGSPVITFPDYP
AFSEVPDKEFQNVMTYLTSIPSLQDAGIGFILVIDRRQDKWTSVKASVLRIAASFPANLQ
LVLVLRPTGFFQRTLSDLAFKFNRDDFKMKVPVIMLSSVPELHGYIDKSQLTEDLGGTLD
YCHTRWLCHRTAIESFALMVKQTAQMLQSFGTELAETELPNDVQSTSSVLCAHTEKKDKA
KEDMRLALDEGQSILESIREPLSKSPEQSLNQDQLDNQTTVQRLLAQLNETEAAFDEFWA
KHQQKLEQCLQLRHFEQDFREVKAALDVLAQKIATFTDVGNSLAHVEHLLKDLASFEEKS
SAAVAQARTLSLDGEQLIDNKHYAVDSIRPKCHELQHLCDQLAAEVAQRRGLLNKSLELH
GLLEASMKWCDEGIYLLASQPVDKCQSQDGAEAALQEIEKFLETGAENKIQELNKIYQDY
EPILTQDLMEHVQKVFQKQESMEEMFHRRQASLKKLAAKQTRPVQPVAPRPEALTKSPCP
SPGVRRGSENNSSEGNALRRGPYRRAKSEMSESRQGRSSSTGDEEESLAILRRHVMNELL
DTERVYVEELLCVLEGYAAEMDNPLMTHLISAGLQNKKDVLFGNMEEIYHFHNRIFLREL
ENYIDCPELVGRCFLERMEEFQIYEKYCQNKPRSESLWRQCSDCPFFQECQKKLDHKLSL
DSYLLKPVQRITKYQLLLKEMLKYSKSCEGAEDLQEALSSILGILKAVNDSMHLIAITGY
DGNLSDLGKLLMQGSFSVWTDHKKGHAKVKDLARFKPMQRHLFLHEKAVLFCKKREENGE
GYEKAPSYSYKQSLNMAAVGITENVKGDVKKFEIWYNAREEVYIIQAPTPEIKAAWVNEI
RKVLTSQLQACREASQHRALEQSQSLPLPASSNTSPSKGNARNVKKLEERKTDPLSLEGY
VSSTTLPKPPEKGKDDTVTSSTSESSALSKKRFTLQGFANLKGQKASPTSPDKKAKRHEV
KSDPTPFGLRGWSKTSHPLEAPEDNDGWSSAEEPINSSDAEEEGGVGPRKLVPGKYTVVV
DDEKGSPNTLAVRSGDVVEVVQEGEEGLWYVRNLTSSKEGWVPASSLSMLLGKSSSAQCL
SSPGKTVPRWLCPEPTGCHHLEPV
Download sequence
Identical sequences G1PG70
ENSMLUP00000009616 ENSMLUP00000009616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]