SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009654 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009654
Domain Number 1 Region: 70-374
Classification Level Classification E-value
Superfamily Ferritin-like 1.11e-117
Family Ribonucleotide reductase-like 0.0000000000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009654   Gene: ENSMLUG00000010596   Transcript: ENSMLUT00000010592
Sequence length 393
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430176:299926:305564:1 gene:ENSMLUG00000010596 transcript:ENSMLUT00000010592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSVRRPLAPLAPLADPQQLKLSPLKGLSLADKENTPPSLNGTRVLASKTARRIFQEPAE
PKTPVPAPGAQEEPLLRENPRRFVVFPIEYHDIWQMYKKAEASFWTAEEVDLSKDLQHWE
ALKSDERYFISHVLAFFAASDGIVNENLVERFSQEVQITEARCFYGFQIAMENIHSEMYS
LLIDTYIKDPKEREFLFNAIETMPCVKKKADWALRWIGDKEATYGERVVAFAAVEGIFFS
GSFASIFWLKKRGLMPGLTFSNELISRDEGLHCDFACLMFKHLLHKPAEQRVKEIITNAV
RIEQEFLTEALPVKLIGMNCTLMKRYIEFVADRLLLELGFSKVVFRVENPFDFMENISLE
GKTNFFEKRVGEYQRMGVMSSPTENSFTLDADF
Download sequence
Identical sequences G1PGA3
ENSMLUP00000009654 ENSMLUP00000009654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]