SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009684 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009684
Domain Number 1 Region: 57-193
Classification Level Classification E-value
Superfamily PH domain-like 0.000000348
Family Phosphotyrosine-binding domain (PTB) 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009684   Gene: ENSMLUG00000010629   Transcript: ENSMLUT00000010624
Sequence length 200
Comment pep:known_by_projection scaffold:Myoluc2.0:GL430176:15923:21004:-1 gene:ENSMLUG00000010629 transcript:ENSMLUT00000010624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDAC
AEFRIRYVGAIEKLKVSEGKRLEGPLDLINYIDVAQQDGKLPFVPLEEEVIMGVSKYGIK
VSTPDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEVSLWVYQCSSLEQA
QAICKVLSTAFDSVLTAEKA
Download sequence
Identical sequences G1PGC8
XP_006102390.1.53796 XP_006102391.1.53796 XP_006102392.1.53796 XP_014323159.1.53796 ENSMLUP00000009684 ENSMLUP00000009684

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]