SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009701 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009701
Domain Number 1 Region: 213-341
Classification Level Classification E-value
Superfamily PX domain 1.05e-25
Family PX domain 0.0018
Further Details:      
 
Domain Number 2 Region: 5-64
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000459
Family SH3-domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009701
Domain Number - Region: 364-571
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0034
Family BAR domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009701   Gene: ENSMLUG00000010647   Transcript: ENSMLUT00000010641
Sequence length 573
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429808:6711739:6719601:1 gene:ENSMLUG00000010647 transcript:ENSMLUT00000010641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKGRALYDFHSENKEEINIQQGEDLVIFSENSLDGWLQGQNSLGETGLFPASYVEIIS
SGTSFNHADYSSSSAGSPGTQVSMYDSSSVANLASGGGSGFLSNQGSFEEDDDDDWDDWD
DGCTVVEEPRAGGMGTNGYSPLNLSYPGAYPSQHMAFRPKPLLERQDSLASAKRGSVVGR
NLNRFSCFVRSGVEAFILGDVPIMAKIAETYSIEMGPRGPQWKANPHPFACSVEDPTKQT
KFKGIKSYISYKLTPTHAGSPVYRRYKHFDWLYNRLLHKFTVISVPHLPEKQATGRFEED
FIEKRKRRLILWMDHMTSHPVLSQYEGFQHFLSCLDDKQWKMGKRRAEKDEMVGASFLLT
FQIPTEHQDLQDVEDRVDTFKAFSKKMDDSVLQLSTVALELVRKHVGGFRKEFQKLGNAF
QAISHAFQMDPPFSSEALNSAISHTGRTYETVGEMFAEQPKNDLFQMLDMLSLYQGLLSN
FPDIIHLQKGAFAKVKESQRMSDEGRMAQDEADGIRRRCRVVGFALQAEMNHFHQRRELD
FKHMMQSYLRQQILFYQRVGQQLEKTLRMYDNL
Download sequence
Identical sequences G1PGE1 S7NKQ8
XP_005882809.1.60319 XP_005882810.1.60319 XP_005882811.1.60319 XP_006087966.1.53796 XP_014385950.1.60319 XP_014385952.1.60319 XP_014385953.1.60319 XP_014385954.1.60319 ENSMLUP00000009701 ENSMLUP00000009701

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]