SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009731 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009731
Domain Number 1 Region: 17-272,746-824
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2e-97
Family Protein kinases, catalytic subunit 0.0000108
Further Details:      
 
Weak hits

Sequence:  ENSMLUP00000009731
Domain Number - Region: 287-333
Classification Level Classification E-value
Superfamily UBA-like 0.0391
Family UBA domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009731   Gene: ENSMLUG00000010657   Transcript: ENSMLUT00000010674
Sequence length 918
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429884:2840520:2962627:-1 gene:ENSMLUG00000010657 transcript:ENSMLUT00000010674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMADGPRHLQRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVN
LEKIYREVQIMKMLDHPHIIKLYQVMETKNMLYLVTEYAKNGEIFDYLANHGRLNESEAR
RKFWQILSAVDYCHGRKIVHRDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSP
PYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFM
SEDCEHLIRRMLVLDPSKRLTIAQIKEHKWMLIEVPVQRPVLYPQGQENEPSIGEFNEQV
LRLMHSLGIDQQKTIESLQNKSYNHFAAIYYLLVERLKSHRSSFPVEQRLDARQRRPSTI
AEQTVAKAQTVGFPVTMHSPNMRLMRSTLLPQASNVEAFSFPASSCQAEAAFMEEECVDT
PKVNGCLLDPVPPVLARKGCQSLPSSMMETSIDEGLETEGEAEEDPSQAFDAFQSTRGGQ
RRHTLSEVTNQLVVVPGSGKVFSMSDNPSLDSVDSEYDMGSVQRDLNFLEDNPSLKDIML
ANQPSPRMASPFISLRPANPAMQALTSQRREAHNRSPVSFREGRRASDTSLTQGIVAFRQ
HLQNLARTKGILELNKVQLLYEQLGPEADPSLVSAAPQLQDLAGSRPQEEAVQQPEGVPA
LATSVHPPLSPQQSLEAQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRFCQC
RLQQKRLFLQKQSQLQAYFNQMQIAESSYPQPHQEAPSPPQQPPPFSLTQPLSPVLAASE
QMQYSPFLGQYPEMPLRPLPSSPGPQAHLQQPPPPPPPPPPPPPQQSGAAPASLQFPYQT
CELPGTVSPEPEYPTPHQYPLDGAQQGGVAAPDCPRSSGLQEDPSSYDPLALPEFPGLFD
CEMLEAVDPQHSGYVLVN
Download sequence
Identical sequences G1PGG7
ENSMLUP00000009731 ENSMLUP00000009731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]