SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009767 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009767
Domain Number 1 Region: 145-468
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.2e-51
Family Diacylglycerol kinase-like 0.0078
Further Details:      
 
Domain Number 2 Region: 42-107
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000105
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009767   Gene: ENSMLUG00000010713   Transcript: ENSMLUT00000010715
Sequence length 493
Comment pep:novel scaffold:Myoluc2.0:GL429925:1435810:1454905:1 gene:ENSMLUG00000010713 transcript:ENSMLUT00000010715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCAQHILQGASADCCGLRVGRGLPQEGPTSASSAKEIVLKPDAKALDAMPHHWIRGNVPL
CSCCVVCTQQCGSQPKLCDYRCIWCQKTVHDECMRSSLKNETCDFGEFRNLIIPPSYLTS
INQMRKDKKTDYAMLASKLGKQWTPLIILANSRSGTNMGDGLLGEFRILLNPVQVFDVTK
TPPIKALQLCTLLPYHSARVLVCGGDGTVGWVLDAIDEMKIKGQEKYIPQVAVLPLGTGN
DLSNTLGWGTSYTGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYYNLRKPKEFTMNNYF
SVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQECKDLNKKVELELDGE
RVELPNLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVVGVYGSFHCAQIQVK
LANPFRIGQAHTVRLILKCSMMPMQVDGEPWAQGPCTVTITHKTHALMLYFSGEQTDDDV
SSNSDQEDIKDTE
Download sequence
Identical sequences G1PGK0
ENSMLUP00000009767 ENSMLUP00000009767

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]