SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMLUP00000009770 from Myotis lucifugus 76_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMLUP00000009770
Domain Number 1 Region: 7-106
Classification Level Classification E-value
Superfamily PH domain-like 2.31e-28
Family Phosphotyrosine-binding domain (PTB) 0.0000185
Further Details:      
 
Domain Number 2 Region: 404-414
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000549
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMLUP00000009770   Gene: ENSMLUG00000010704   Transcript: ENSMLUT00000010719
Sequence length 1031
Comment pep:known_by_projection scaffold:Myoluc2.0:GL429769:27035231:27038570:1 gene:ENSMLUG00000010704 transcript:ENSMLUT00000010719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAEPPFYKDVWQVIVKPGLGHRKELSGVFRLCLTDEEVVFVRLNTEVASVVVQLLSIRRC
GHSEQYFFLEVGRSTVIGPGELWMQVDDCVVAQNMHELFLEKMKALCADEYRARCRSYSI
SIGAHLLTLLSTRRHLDMVPPEPGGWLRRSRFEQFCHLRAIGDGKNEMLLTRHSVTPSEP
VPHSRRGRLHLPRARRSRRTISVPASFFRRLAPCPVRARQTTEPPSDRVCLFSEASSSGS
GNSGEEGNPQGQAGQEGNTGDYMPMNNWGSGGGQGSSGQGSSSQSSGGNQCSGRGQGSGG
GQGCSGGQGSGGQGAGGNQCSGNGQSPAGGHGSSSSQGASGGHGSGSGQGPGDGHNSGGG
KNSGGGKGSGSGKDSDGNGEWAKSLKKRSYFGKLIQSKQQQMPPPPPPPPPPPPAGATGG
KGKSGGRFRLYFCADRAATKERKEVKDTETLEGAARGPHRARAFHEDEDDPYVPMRPGVA
APLESSSDYMPMAPQNVSASVKYHSRASFEDSRGYMMMFPRVSPPPAPIPPKASDPDKKD
DSKDNDSDSDYMFMAPGAGAIPKKPPNPQGGSSSKSWSSYFSLPKTFRSSPLGQSDHSEY
VPMLSGKLLGKGLDKEASSIRGPKYAASKPSVEGFEATLQSVSKPGDGSSPSKPSDDGPP
KDQAKRPNQLSFMTKGNKIEPKTQKPTREQREADSSSDYVNLDFTERSSNMPAPVTQGLP
HSWGIIANPRQSAFSHYMNIEFRVPFRNATNVLSNLLRAIPGANRFFLDSTRPLLPLLNS
ATGSNANEEECEYIEVTFNPAMAPALPFGDRAIRYDAETGRIYVVDPFSECCMDISLSPS
RCSEPPPVARLLQEEELERSPQSRSQSVFASTRAAVSAFPTDSLERDLYTSRGSTSAVGS
EPTLAVGRALAAASALAAVPGMGAAAAGFEAASGFNSASACWFQPVANAAGAAAGAEAVR
GAHVVGGSNPRAENPSADLARGENGAGEAAAAAAAPPPPPRHWLPRLPEREDSDEEDTYV
RMDFAGPEHRK
Download sequence
Identical sequences G1PGK3
ENSMLUP00000009770 ENSMLUP00000009770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]